DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and HMS1

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_014675.1 Gene:HMS1 SGDID:S000005558 Length:434 Species:Saccharomyces cerevisiae

Alignment Length:200 Identity:47/200 (24%)
Similarity:71/200 (36%) Gaps:70/200 (35%)


  Fly     2 SDNNNALATKE-----DVFGMEHDQ--------DHTSKHYSRCSSAGS----------------- 36
            :||.|.:.::|     :||..|.::        |..|:..|...||.|                 
Yeast   150 TDNGNTIDSEEYIDNMEVFSSEENENIDNVKQTDLKSEKDSSLLSAASIVKKEQLSGFENFLPLS 214

  Fly    37 -THTPNSSA---------HNSDDDDDSGDARHSAAANSTLSYKERR-------REAHTQAEQKRR 84
             |.:|..:|         .|.|:.|.......::........|.:|       |.:|...|:|.|
Yeast   215 KTESPLVTADEIKSSLNLENIDNADSMSFKLKTSPIRKHFHVKPKRITRVRTGRVSHNIIEKKYR 279

  Fly    85 DAIKKGYDSLQELVP-------RCQPND--------------SSGYKLSKALILQKSIEYIGYLN 128
            ..|....:.|:..||       :|  ||              ....||:||.||.||||||.:|.
Yeast   280 SNINDKIEQLRRTVPTLRVAYKKC--NDLPITSRDLADLDGLEPATKLNKASILTKSIEYICHLE 342

  Fly   129 QQKLK 133
            ::.|:
Yeast   343 RKCLQ 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 27/89 (30%)
HMS1NP_014675.1 HLH 268..342 CDD:278439 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.