DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and RTG3

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_009447.1 Gene:RTG3 SGDID:S000000199 Length:486 Species:Saccharomyces cerevisiae

Alignment Length:229 Identity:54/230 (23%)
Similarity:87/230 (38%) Gaps:53/230 (23%)


  Fly    35 GSTHTP----NSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQ 95
            ||.:||    .|.:.|..::...|.........::.....|:||.|...|::||:.||:....|.
Yeast   245 GSINTPRTRHTSISSNMTENIGPGSVPKILGGLTSDEKLRRKREFHNAVERRRRELIKQKIKELG 309

  Fly    96 ELVPRCQPN-DSSG--YKLSKALILQKSIEYIGYLNQ-------------QKLKQEDEGSALQKE 144
            :|||....| |..|  .|.:|.:||.:::||:.||.:             .|:|:.:|   .:..
Yeast   310 QLVPPSLLNYDDLGKQIKPNKGIILDRTVEYLQYLAEILEIQARKKKALLAKIKELEE---KKSS 371

  Fly   145 VTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEM-------------------- 189
            |.||....|.:.  ....|.|....|.|:.|..  .|..|:|.|.                    
Yeast   372 VAALSPFTNNHH--ASSGQNNSENSEERIIDIR--SVPNALMNEQNSKAELHNWEPPLYDSVGNH 432

  Fly   190 -----FETFQHIPM-ENFKQLTTGIIPWLEEHCK 217
                 .|:..|..: |..|:..:|.:...|::.|
Yeast   433 NHAGTMESHPHTNIHEELKEFLSGDLIEAEDNAK 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 24/77 (31%)
RTG3NP_009447.1 HLH 284..349 CDD:238036 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.