DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and PIL2

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001078329.1 Gene:PIL2 AraportID:AT3G62090 Length:363 Species:Arabidopsis thaliana

Alignment Length:208 Identity:53/209 (25%)
Similarity:86/209 (41%) Gaps:48/209 (23%)


  Fly    32 SSAGSTHTPNSSAH-NSDDDDDSGDARHSAAANSTLSYKERRR--EAHTQAEQKRRDAIKKGYDS 93
            ||.|.|.....|.: :|..||:|.|||....|.:..:..:|:|  ||:...|:.:|:.|.|...:
plant   146 SSVGFTEDSEGSMYLSSSLDDESDDARPQVPARTRKALVKRKRNAEAYNSPERNQRNDINKKMRT 210

  Fly    94 LQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNG--YE 156
            ||.|:|....:|:..       :|.::|.|:..| |.:::....|:   :.||...::..|  |.
plant   211 LQNLLPNSHKDDNES-------MLDEAINYMTNL-QLQVQMMTMGN---RFVTPSMMMPLGPNYS 264

  Fly   157 NM---------LQHQQANP----GPEEARLTDEAKFQVFQAIMEEMFETFQH---IPMENFKQLT 205
            .|         :..||..|    |.....:.|.|          :|.....|   :||:|    :
plant   265 QMGLAMGVGMQMGEQQFLPAHVLGAGLPGINDSA----------DMLRFLNHPGLMPMQN----S 315

  Fly   206 TGIIPWLEEHCKP 218
            ...||  .|:|.|
plant   316 APFIP--TENCSP 326

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 18/63 (29%)
PIL2NP_001078329.1 HLH 197..242 CDD:197674 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
21.960

Return to query results.
Submit another query.