DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and PIL6

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001030889.1 Gene:PIL6 AraportID:AT3G59060 Length:444 Species:Arabidopsis thaliana

Alignment Length:263 Identity:63/264 (24%)
Similarity:103/264 (39%) Gaps:56/264 (21%)


  Fly     5 NNALATKEDVFG------------MEHDQDHTSKHYSRCSSAGSTHTPNSSAHNSDDDDDSGDAR 57
            ||    ||.|.|            |:.||:..|:     |..|.|.|.:.:..|. ....||..|
plant   199 NN----KETVSGTSVTIDRKRKHVMDADQESVSQ-----SDIGLTSTDDQTMGNK-SSQRSGSTR 253

  Fly    58 HSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSLQELVPRCQPNDSSGYKLSKALILQKSIE 122
            .|.||           |.|..:|::|||.|.:...:||||:|.|...|       ||.||.::|:
plant   254 RSRAA-----------EVHNLSERRRRDRINERMKALQELIPHCSRTD-------KASILDEAID 300

  Fly   123 YIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIME 187
            |:..| |.:|:....||.:.....|.     ....|....|::|...:..:..:.:...|..:..
plant   301 YLKSL-QMQLQVMWMGSGMAAAAAAA-----ASPMMFPGVQSSPYINQMAMQSQMQLSQFPVMNR 359

  Fly   188 EMFETFQHIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTLQQMAQEAMEKQELQAMEQESSE- 251
            ...:....:..:|..|        |:...:..||...|:|.:..:.|......::|.::|:.:: 
plant   360 SAPQNHPGLVCQNPVQ--------LQLQAQNQILSEQLARYMGGIPQMPPAGNQMQTVQQQPADM 416

  Fly   252 -GF 253
             ||
plant   417 LGF 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 22/61 (36%)
PIL6NP_001030889.1 HLH 262..310 CDD:197674 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.