DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and PIL1

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_182220.2 Gene:PIL1 AraportID:AT2G46970 Length:416 Species:Arabidopsis thaliana

Alignment Length:248 Identity:65/249 (26%)
Similarity:105/249 (42%) Gaps:31/249 (12%)


  Fly    24 TSKHYSRCS---SAGSTHTPNSS--AHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKR 83
            ||:..|.||   ..|......|:  ::||||:.|....:..|.....::.::|..|.|...|:||
plant   177 TSRDLSCCSLKRKYGDIEEEESTYLSNNSDDESDDAKTQVHARTRKPVTKRKRSTEVHKLYERKR 241

  Fly    84 RDAIKKGYDSLQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTAL 148
            ||...|...:||:|:|.|       ||..||.:|.::|:|:..| |.:::....|:.|.:..|.|
plant   242 RDEFNKKMRALQDLLPNC-------YKDDKASLLDEAIKYMRTL-QLQVQMMSMGNGLIRPPTML 298

  Fly   149 RIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQHIP--MENFKQLTTGIIP- 210
            .:.......:..|..|...|     |...:|.... :....|....:.|  |.:|....:|:|| 
plant   299 PMGHYSPMGLGMHMGAAATP-----TSIPQFLPMN-VQATGFPGMNNAPPQMLSFLNHPSGLIPN 357

  Fly   211 -----WLEEHCKPHILRNILSRT----LQQMAQEAMEKQELQAMEQESSEGFS 254
                 .||...:|.::.:.:|:|    ..|..:.|.......||:...|.|||
plant   358 TPIFSPLENCSQPFVVPSCVSQTQATSFTQFPKSASASNLEDAMQYRGSNGFS 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 23/61 (38%)
PIL1NP_182220.2 HLH 238..283 CDD:197674 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193489
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
32.960

Return to query results.
Submit another query.