DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and MLX

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_733752.1 Gene:MLX HGNCID:11645 Length:298 Species:Homo sapiens

Alignment Length:210 Identity:102/211 (48%)
Similarity:142/211 (67%) Gaps:10/211 (5%)


  Fly    29 SRCSSAGSTHTPNSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDS 93
            ||.:|.|||..  ||..|:||:|..   .|..|...  |||:|||.||||||||||||||:|||.
Human    94 SRANSIGSTSA--SSVPNTDDEDSD---YHQEAYKE--SYKDRRRRAHTQAEQKRRDAIKRGYDD 151

  Fly    94 LQELVPRCQPNDSS--GYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYE 156
            ||.:||.||..|.|  ..|||||::|||:|:||.:|:::|.|||:|.|.|:|:||||:|:|..||
Human   152 LQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYE 216

  Fly   157 NMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQ-HIPMENFKQLTTGIIPWLEEHCKPHI 220
            .:::..|.||...|.:::|:.||.|||.||:.:|::|. .|.:.:|::|:..:..|:||||||..
Human   217 QIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQT 281

  Fly   221 LRNILSRTLQQMAQE 235
            ||.|:...|.|:..:
Human   282 LREIVIGVLHQLKNQ 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 41/63 (65%)
MLXNP_733752.1 HLH 130..188 CDD:306515 39/58 (67%)
Leucine-zipper 140..160 15/20 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214691367
eggNOG 1 0.900 E1_KOG1319
Hieranoid 1 1.000
Homologene 1 1.000 H7969
Inparanoid 1 1.050 189 1.000 Inparanoid score I3846
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1234389at2759
OrthoFinder 1 1.000 FOG0005762
OrthoInspector 1 1.000 T1073767
orthoMCL 1 0.900 OOG5_132269
Panther 1 1.100 LDO PTHR15741
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5340
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.