DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and mlx

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_017209811.1 Gene:mlx ZFINID:ZDB-GENE-050522-316 Length:253 Species:Danio rerio

Alignment Length:257 Identity:103/258 (40%)
Similarity:153/258 (59%) Gaps:34/258 (13%)


  Fly     1 MSDNNNALATKEDVF-----------GMEH----DQDHTSKHYSRCSSAGSTHTPNSSAHNSDDD 50
            |::|:   |:.||.:           |.:|    :........||.:|.|||..  ||..|:||:
Zfish     1 MTENS---ASPEDPWLKQTDGTFSDNGFDHSFFAESARKGSLVSRANSIGSTSA--SSVPNTDDE 60

  Fly    51 DDSGDARHSAAANSTLSYKERRREAHTQAEQKRR------DAIKKGYDSLQELVPRCQPNDS--- 106
            |  .|.||......  |||:|||.||||||||||      ||.:||||.||.:||.||....   
Zfish    61 D--SDNRHETPYKE--SYKDRRRHAHTQAEQKRRDNQGMCDAFQKGYDDLQSIVPTCQQQSDFSM 121

  Fly   107 SGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQANPGPEEA 171
            :..|:|||.:|||:|:||.:|:::|.|||::.|.|:|||.||:|:|..||::::..|.||.....
Zfish   122 ATQKMSKATVLQKTIDYIQFLHKEKKKQEEDVSTLRKEVMALKIMKTNYEHIVKAHQNNPQQGSE 186

  Fly   172 RLTDEAKFQVFQAIMEEMFETFQ-HIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTLQQM 232
            :::|:.||.|||:||:.:|::|. .:.:.:|::|:..:..|:||||||..||..:...|||:
Zfish   187 QVSDQVKFSVFQSIMDSLFQSFSASVSVSSFQELSACVFSWIEEHCKPQTLREFVVTVLQQV 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 37/70 (53%)
mlxXP_017209811.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214688991
eggNOG 1 0.900 E1_KOG1319
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H7969
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1234389at2759
OrthoFinder 1 1.000 FOG0005762
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132269
Panther 1 1.100 LDO PTHR15741
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.