DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and Mondo

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001163032.1 Gene:Mondo FlyBaseID:FBgn0032940 Length:1119 Species:Drosophila melanogaster

Alignment Length:246 Identity:60/247 (24%)
Similarity:111/247 (45%) Gaps:50/247 (20%)


  Fly    39 TPNSSAHNSDDDDDSGDARHSAAANSTLSYKER---RREAHTQAEQKRRDAIKKGYDSLQELVPR 100
            :|.|:.|.|.|.        ..:..::|.::.|   ||..|..||||||..||.|:|:|..|:|:
  Fly   884 SPESTFHESQDS--------PLSPTTSLKFQPRDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQ 940

  Fly   101 CQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQ-- 163
            .|.|.::  |||||.:|||..::|..|.|::       :.|:.::.|||:.::...|.|.|..  
  Fly   941 LQLNPNA--KLSKAAMLQKGADHIKQLRQER-------NVLKDKIEALRMERDELNNSLTHLHSI 996

  Fly   164 --ANPGPEEARLTDEA----------------KFQVFQAIMEEMFETF-QHIPMENFKQLTTGII 209
              ||..|...:.|:..                ||.:...|:|.:..:: ..:...:..:|.....
  Fly   997 LPANGAPVTRQGTEHVRQLYDIYVRYNTMNDWKFWILGLILEPLLASYTSTVSSASLDELRRTAF 1061

  Fly   210 PWLEEHCKPHILRNILSRTLQQMAQ---------EAMEKQELQAMEQESSE 251
            .|:::||....||..::..|:.::.         ..::::..:|::..|.:
  Fly  1062 LWVDQHCSLIDLRPAVTNKLKYLSMHTDIVSEPPSTLQEEVAKALQNSSGQ 1112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 30/64 (47%)
MondoNP_001163032.1 HLH 909..969 CDD:238036 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107393017
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR15741
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.