DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and crp

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001285976.1 Gene:crp FlyBaseID:FBgn0001994 Length:631 Species:Drosophila melanogaster

Alignment Length:249 Identity:59/250 (24%)
Similarity:88/250 (35%) Gaps:66/250 (26%)


  Fly    30 RCSSAGSTHTPNSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYDSL 94
            |.||...|:|..............||.......:|.   |..|||.....|::|..:|..|:.||
  Fly    58 RQSSMSGTNTSKGGGGGGSGALSDGDGSGKPLVDSE---KRMRREIANSNERRRMQSINAGFQSL 119

  Fly    95 QELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENML 159
            :.|:||     ..|.|||||.|||::.:||..|..||.:...:.|.|:::|.             
  Fly   120 RSLLPR-----HEGEKLSKAAILQQTFQYIVELENQKTQLLTQNSELKRQVG------------- 166

  Fly   160 QHQQANPGP-------------------------EEARLTDEAKFQVFQAIMEEMFETFQHIPME 199
            :|:....|.                         ::.:|||..  ...|||.:...|....:..|
  Fly   167 EHEAGGSGDGGGTNSGGNYNDSNASGGNSTAVAIKKRKLTDNV--INIQAISDSSDEGLGSMSPE 229

  Fly   200 NFKQLTTG------------IIPWLEEH------CKPHILRNILSRTLQQMAQE 235
            ....||.|            ::...|.|      .|...||.:|...||.:.::
  Fly   230 PMTLLTAGGAAATKLSNAATLLAAKELHESKKQLEKERSLRRLLEDELQMIKRQ 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 25/61 (41%)
crpNP_001285976.1 HLH 97..148 CDD:278439 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107392107
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR15741
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.