DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and sre1

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_595694.1 Gene:sre1 PomBaseID:SPBC19C2.09 Length:900 Species:Schizosaccharomyces pombe

Alignment Length:230 Identity:48/231 (21%)
Similarity:81/231 (35%) Gaps:77/231 (33%)


  Fly     1 MSDNNNALATKEDVFGMEHDQDHTSKHYSRCSSAGSTHTPNSSAHN---SDDDDDS--------- 53
            ||:....|.|:|.:..|:                 :|..|..||..   |...:||         
pombe   188 MSNPEVKLKTEEIITPMD-----------------TTCKPEPSAKKIKLSPSSEDSCSIPETLPF 235

  Fly    54 --GDARHSAAANSTLSY-----KERRREAHTQAEQKRRDAIKKGYDSLQELVP--------RC-- 101
              ..:|.|.:.:.|..:     .:.::.||...|::.|..:......|::.||        ||  
pombe   236 SAPKSRGSLSPSETPDFVAGPGGKPKKTAHNMIEKRYRTNLNDRICELRDAVPSLRAAAALRCGN 300

  Fly   102 --QPNDSSGY----KLSKALILQKSIEYIGYLN------QQKLKQEDEGSALQKE---------- 144
              ...|..|.    ||:|..||.|:.|||.:|.      |:..||..:..|..::          
pombe   301 SLDDEDLGGLTPARKLNKGTILAKATEYIRHLEAKNKELQKTNKQLSDRLAFYEDPSMAPPSNDT 365

  Fly   145 --VTALRIIKNGYENMLQHQQANPGPEEARLTDEA 177
              |.::.::.:...::  ||.:.|     .||..|
pombe   366 RAVNSVNVVSSSDYSV--HQSSRP-----NLTQRA 393

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 22/83 (27%)
sre1NP_595694.1 HLH 261..333 CDD:278439 21/72 (29%)
DUF2014 517..766 CDD:286510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.