DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and Mlx

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_035680.3 Gene:Mlx MGIID:108398 Length:298 Species:Mus musculus

Alignment Length:223 Identity:102/224 (46%)
Similarity:147/224 (66%) Gaps:10/224 (4%)


  Fly    16 GMEHDQDHTSKHYSRCSSAGSTHTPNSSAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAE 80
            |:..:..|.....||.:|.|||..  ||..|:||:|  .|.:..:...   |||:|||.||||||
Mouse    81 GLFVESTHKGSVVSRANSIGSTSA--SSVPNTDDED--SDYQQESYKE---SYKDRRRRAHTQAE 138

  Fly    81 QKRRDAIKKGYDSLQELVPRCQPNDSS--GYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQK 143
            ||||||||:|||.||.:||.||..|.|  ..|||||::|||:|:||.:|:::|.|||:|.|.|:|
Mouse   139 QKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRK 203

  Fly   144 EVTALRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETFQ-HIPMENFKQLTTG 207
            :||||:|:|..||.:::..|.||...|.:::|:.||.|||.||:.:|::|. .|.:.:|::|:..
Mouse   204 DVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSAC 268

  Fly   208 IIPWLEEHCKPHILRNILSRTLQQMAQE 235
            :..|:||||:|..||.|:...|.|:..:
Mouse   269 VFSWIEEHCEPQTLREIVIGVLHQLKNQ 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 41/63 (65%)
MlxNP_035680.3 HLH 130..188 CDD:278439 39/58 (67%)
Leucine-zipper 194..214 12/20 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214690732
eggNOG 1 0.900 E1_KOG1319
Hieranoid 1 1.000
Homologene 1 1.000 H7969
Inparanoid 1 1.050 190 1.000 Inparanoid score I3856
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005762
OrthoInspector 1 1.000 T1083843
orthoMCL 1 0.900 OOG5_132269
Panther 1 1.100 LDO PTHR15741
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5340
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.