DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and mxl-2

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_497173.1 Gene:mxl-2 WormBaseID:WBGene00003510 Length:205 Species:Caenorhabditis elegans

Alignment Length:187 Identity:48/188 (26%)
Similarity:93/188 (49%) Gaps:11/188 (6%)


  Fly    29 SRCSSAGSTHTPNS-SAHNSDDDDDSGDARHSAAANSTLSYKERRREAHTQAEQKRRDAIKKGYD 92
            ||.::|.|:..|:. ...:.|....|..|.::.|.||.....:|::..|.:.|::||:||..||.
 Worm     4 SRSAAASSSQKPDDMDLMSPDGSASSPSAPNTPATNSGGFSSDRKKATHLRCERQRREAINSGYS 68

  Fly    93 SLQELVPRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYEN 157
            .|::|:|  |...|.|.|.:.|.||.::.:::..|.......:.:.:.|..:..||.:|.:.|| 
 Worm    69 DLKDLIP--QTTTSLGCKTTNAAILFRACDFMSQLKTDISDADKQLAQLNAQAAALEMIASEYE- 130

  Fly   158 MLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETF-QHIPMENFKQLTTGIIPWLE 213
                |.|:..|:..:.|.:.|  :.|.::::.|.:| ..:....:..:|..::.|:|
 Worm   131 ----QMASSVPDAGQSTIQVK--MLQLLLDDCFTSFSSQVDFTTYATITRTLLSWVE 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 20/61 (33%)
mxl-2NP_497173.1 HLH 47..106 CDD:238036 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1319
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3864
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005762
OrthoInspector 1 1.000 T474465
orthoMCL 1 0.900 OOG5_132269
Panther 1 1.100 LDO PTHR15741
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5340
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.