DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: bigmax and mlx

Sequence 1:NP_651556.2 Gene:bigmax FlyBaseID:FBgn0039509 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_004918784.1 Gene:mlx ID: Length:226 Species:Xenopus tropicalis

Alignment Length:216 Identity:101/217 (47%)
Similarity:142/217 (65%) Gaps:15/217 (7%)


  Fly    29 SRCSSAGST---HTPNSSAHNSDD------DDDSGDARHSAAANSTLSYKERRREAHTQAEQKRR 84
            ||.:|.|||   ..||::.:..|:      ||:..|.|.....|   .||:|||.||||||||||
 Frog     9 SRANSIGSTSASSVPNTACNMMDNACSLTSDDEDSDDRQETIKN---DYKDRRRRAHTQAEQKRR 70

  Fly    85 DAIKKGYDSLQELVPRCQPNDSS--GYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTA 147
            ||||||||.||.:||.||..|.:  ..|||||::|||:|:||.:||::|.||||:.|.|:|||.|
 Frog    71 DAIKKGYDDLQCIVPTCQQQDIAIGTQKLSKAVVLQKTIDYIQFLNKEKKKQEDDVSTLRKEVMA 135

  Fly   148 LRIIKNGYENMLQHQQANPGPEEARLTDEAKFQVFQAIMEEMFETF-QHIPMENFKQLTTGIIPW 211
            |:|:|:.||.:::..|.|......::.||.||:|||.||:.:|.|| ..:.:.:|::|:..:..|
 Frog   136 LQIMKSNYEQIVKAHQNNLHEGTDQVPDEMKFRVFQGIMDSLFHTFNSSVSVNSFQELSACVFAW 200

  Fly   212 LEEHCKPHILRNILSRTLQQM 232
            :||||||..|::|:.|.|.|:
 Frog   201 IEEHCKPQTLQDIVIRFLHQL 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
bigmaxNP_651556.2 HLH 69..130 CDD:238036 42/63 (67%)
mlxXP_004918784.1 HLH 58..115 CDD:278439 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H7969
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1234389at2759
OrthoFinder 1 1.000 FOG0005762
OrthoInspector 1 1.000 T1059833
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.