DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5938 and Chic2

Sequence 1:NP_001097947.2 Gene:CG5938 FlyBaseID:FBgn0046247 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_083126.1 Gene:Chic2 MGIID:1921527 Length:165 Species:Mus musculus

Alignment Length:165 Identity:105/166 (63%)
Similarity:140/166 (84%) Gaps:1/166 (1%)


  Fly     4 SDFDAIYEDEQLDELEHFQDQTVAPVQEPIIIRGAGNMTVFGLSNRFNAEFPCGLLSRVAPEEFK 68
            :|||.|||:|: ||....::|.:....:|:::||:|::|||||||:|.:|||..|..:|||||||
Mouse     2 ADFDEIYEEEE-DEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFK 65

  Fly    69 ATVGRINGVLKKSLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTLDKLFEWENNHLYHKL 133
            |::.|:|..|:|:|||||:||.|||:|||||||||:||||||||||:.:::||.|||||.|||||
Mouse    66 ASINRVNSCLRKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKL 130

  Fly   134 GLHWRLHKQQCDSNSMMEYVILIEFIPKTPIYRPD 168
            .|||||.|::|::|:||||||||||:|||||:|||
Mouse   131 CLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5938NP_001097947.2 Erf4 49..137 CDD:287258 60/88 (68%)
Chic2NP_083126.1 Erf4 46..134 CDD:337682 60/88 (68%)
CHIC motif (Cys-rich) 88..106 16/18 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C255061223
eggNOG 1 0.900 E1_KOG4101
Hieranoid 1 1.000
Homologene 1 1.000 H8105
Inparanoid 1 1.050 248 1.000 Inparanoid score I3216
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002463
OrthoInspector 1 1.000 T615870
orthoMCL 1 0.900 OOG5_131856
Panther 1 1.100 LDO PTHR13005
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4938
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.