DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3MBTL4

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_011524059.1 Gene:L3MBTL4 HGNCID:26677 Length:651 Species:Homo sapiens

Alignment Length:722 Identity:225/723 (31%)
Similarity:323/723 (45%) Gaps:144/723 (20%)


  Fly   790 RQTNYKPHKSLSAIQEQLQQ----RQKDKPRKP------------------FRWSEYLKSKGKDV 832
            :|.|.|...::.: :|:|.|    .|.::.:||                  :.|..|||.: |.|
Human     2 KQPNRKRKLNMDS-KERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKEQ-KAV 64

  Fly   833 AAPIHLFL--NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWV 895
            |||:.||.  ..||...|.|:|||:||.|||.:.|:|||.|:.||.||||:|.||||.|.||||.
Human    65 AAPVELFSKDQSFPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWT 129

  Fly   896 NADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGF 960
            ||.|.||.|.|||::|...|..||.|..::|.|..||.....:.||:.||  .|......:...|
Human   130 NAGSPDIHPVGWCEKTKHELHIPKGYRKDKFVWMDYLKACKLQNAPKKLF--RNRSPNGPMSKEF 192

  Fly   961 AVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-HEGRQQL 1024
            .|||.|||.|..:...:||||:.||:::|:.||||.|||.||.|..:.|||:.|.|| .|..:.|
Human   193 QVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPYVQPVGWCQENGRTL 257

  Fly  1025 IVPPDY-QKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRK 1088
            |.|..| ....|.|.:|:......|...::|..|.|..:...|||||||:|||.|||.||:|...
Human   258 IAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFLPNMKLEVVDKRNPRLIRVATIVDVD 322

  Fly  1089 GYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMP----CDVEGCRG 1149
            ..||::|.|.|..:|.:|:|.||||:||||||:.|.|.||.|......| ::|    |...||||
Human   323 DQRVKVHFDGWDHKYDYWVEADSPDIHPIGWCDVTGHPLEVPQRTNDLK-ILPGQAVCPTPGCRG 386

  Fly  1150 FGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENIRRGWA-KKTKRACSEAKQAIKE 1213
            .|:.:....:.|.....|||:..|.::..:...:.......|:....: .|:|..||     :..
Human   387 IGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLESDSSHSKSKSLCS-----LNF 446

  Fly  1214 DSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKE-----------------EDAEQVPDER 1261
            :.:.|.|..:...|.|||     |.:  :|.::.:..:                 |.|:||..: 
Human   447 NGKHEKVNSQPRLVQQAK-----CLK--IKGKEDIDLDNLFRVLVLHPRGLEYSVEQAQQVLHQ- 503

  Fly  1262 SLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPL-HWTSWDVCEYIERALDSTDIAKVIF 1325
              :::.|.|..:..:.||..|.........:.|:|.:.: .||..:|.|:::..|...:.||.. 
Human   504 --SVSMSTVSAHPFRDLPLGREQHCKLLPGVADIRASQVARWTVDEVAEFVQSLLGCEEHAKCF- 565

  Fly  1326 EQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKFDSKNIELESNTAGPI-QRE 1389
                         :||                                     ||:..|.: ||.
Human   566 -------------KKE-------------------------------------ESSEPGCVNQRR 580

  Fly  1390 MDTPVSAIKQLPEQSQTNGYKTDHDQELSESGDDDDDEDVMLDSDDFLSVKPSCLVIDEDADGDG 1454
            ..:|.|.       ::..|        .|.|.........:..||.:.|:..|        |.||
Human   581 CSSPWSC-------AEVTG--------ASRSWGKQPTRWPLPSSDRWQSLPAS--------DTDG 622

  Fly  1455 DCESDGD 1461
            .|:||.|
Human   623 HCQSDED 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 54/98 (55%)
MBT 929..1028 CDD:214723 42/100 (42%)
MBT 1038..1130 CDD:214723 43/92 (47%)
SAM_PNT 1279..1366 CDD:280377 13/88 (15%)
L3MBTL4XP_011524059.1 MBT 57..149 CDD:214723 53/93 (57%)
MBT 164..260 CDD:214723 41/98 (42%)
MBT 273..364 CDD:214723 43/91 (47%)
zf-C2HC 379..405 CDD:279824 8/26 (31%)
SAM_superfamily 540..>569 CDD:301707 9/80 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86198291
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 1 1.000 T609620
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.771 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.