DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and SAMD1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_612361.1 Gene:SAMD1 HGNCID:17958 Length:538 Species:Homo sapiens

Alignment Length:328 Identity:68/329 (21%)
Similarity:113/329 (34%) Gaps:102/329 (31%)


  Fly  1112 PDLHPIGWCEATSHELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPY----APE 1172
            |.|.|.....|...:.:.||...||    |.:....|..|.|:..     :|||...|    ...
Human   209 PPLPPPPQPPAPPQQQQPPPPQPQP----PPEGGAVRAGGAARPV-----SLREVVRYLGGSGGA 264

  Fly  1173 NWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPC 1237
            ..|..|.:.  ...:..|...||..::|:.......:..:....     |..|....::.|... 
Human   265 GGRLTRGRV--QGLLEEEAAARGRLERTRLGALALPRGDRPGRA-----PPAASARPSRSKRGG- 321

  Fly  1238 EEKVVKKQKQMQKEEDAE---------QVPD--------------ERSLAIARSFVKDY------ 1273
            ||:|::|:::...:||.:         :||:              ||....|:..||::      
Human   322 EERVLEKEEEEDDDEDEDEEDDVSEGSEVPESDRPAGAQHHQLNGERGPQSAKERVKEWTPCGPH 386

  Fly  1274 -------GPQFLPN------YRLWQLNSAFKLDDVRT---------------------------- 1297
                   ||  .|.      :.:..:|.......|.|                            
Human   387 QGQDEGRGP--APGSGTRQVFSMAAMNKEGGTASVATGPDSPSPVPLPPGKPALPGADGTPFGCP 449

  Fly  1298 --------NPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAV 1354
                    :|:.||..||.||...| ...:.|....||:|||::||::.|.::.|.|.:::|||:
Human   450 PGRKEKPSDPVEWTVMDVVEYFTEA-GFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPAL 513

  Fly  1355 KLY 1357
            |:|
Human   514 KIY 516

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723 4/18 (22%)
SAM_PNT 1279..1366 CDD:280377 28/122 (23%)
SAMD1NP_612361.1 SAM_Atherin-like 459..527 CDD:188982 24/60 (40%)
SAM 459..525 CDD:197735 24/60 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.