DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3MBTL3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_006715639.1 Gene:L3MBTL3 HGNCID:23035 Length:815 Species:Homo sapiens

Alignment Length:904 Identity:271/905 (30%)
Similarity:414/905 (46%) Gaps:178/905 (20%)


  Fly   543 SSSSDSSSYSDVEVVPTKKTEKELSMLPG------------ISIIKAES---------------L 580
            :.|:.|:|..:.:|......:..:..|||            :.:|..|:               :
Human     2 TESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATATTTWMV 66

  Fly   581 PLSRE----DFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKAND 641
            |.::|    |..:||          |...||:......:.|...||...|.|:|||:........
Human    67 PTAQEAYTGDLAKSL----------PLFFSSTPMVVTNTYMLMTPKSTSPAPTSPPSSRPVFPPA 121

  Fly   642 HDANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAY 706
            :..:| |...|...:|:.|      .:|.:.|..::.                            
Human   122 YWTSP-PGCPTVFSEKTGM------PFRLKDPVKVEG---------------------------- 151

  Fly   707 FERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFLA-PHFCSVGCVR------RSQKRRLPQS 764
                                |..|:.|..:|...:.|: .::||..|.|      :.::|.:.:.
Human   152 --------------------LQFCENCCQYGNVDECLSGGNYCSQNCARHIKDKDQKEERDVEED 196

  Fly   765 TQKE----SKISRTQLEQTAGTAPDLPQK--RQTNYKPHKSLSAIQEQLQQRQKD---------- 813
            .::|    |:..:.:|...|.|..|..::  ...|.:..:.|...|...::|:.|          
Human   197 NEEEDPKCSRKKKPKLSLKADTKEDGEERDDEMENKQDVRILRGSQRARRKRRGDSAVLKQGLPP 261

  Fly   814 KPRKPFRWSEYLKSKGKDVAAPIHLFL--NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVR 876
            |.:|.:.|:.||:.: |.||.|..||.  ..||.:.|.|::|||||.:|||:.|::||.::.||.
Human   262 KGKKAWCWASYLEEE-KAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVC 325

  Fly   877 GYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAP 941
            |||:||.|||||..||||||||:.||.|.|||::|...|..||.|..|.|:|..||.....:|||
Human   326 GYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAP 390

  Fly   942 RALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVH 1006
            ::||.:.|:..   :.:||.|||.|||.|..:...||||||||::|.|..||||.||:.||.|..
Human   391 KSLFENQNITV---IPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCE 452

  Fly  1007 ITSPYIHPCGW-HEGRQQLIVPPDYQK-SAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLE 1069
            .:||:|||.|| .|.|:.||.||.|.. ..|.||.|:.|...:.|....|..:.|..:|::||||
Human   453 ASSPHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLE 517

  Fly  1070 VVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYL 1134
            |||:|||..||.|||.....:||::|.|.|...|.:|::.||||:||:|||..|.|.|:.|   |
Human   518 VVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPP---L 579

  Fly  1135 QPKSVMP------CDVEGCRGFGNAKRF-NLNVHALRECCPYAPENWRQWRSKTVKPPRVA---- 1188
            .|..:|.      |...||:|.|:.||. :|..|:... |||:..|..:.|   :.|.|::    
Human   580 SPLELMEASEHGGCSTPGCKGIGHFKRARHLGPHSAAN-CPYSEINLNKDR---IFPDRLSGEMP 640

  Fly  1189 ------PENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQ 1247
                  |.|      |:|....|.:...|: |...:.|.....|..:::.:||        .:.:
Human   641 PASPSFPRN------KRTDANESSSSPEIR-DQHADDVKEDFEERTESEMRTS--------HEAR 690

  Fly  1248 MQKEEDAEQVPDERSLAIARSFVKDYGPQFLPNYRL-WQLNSAFKLDDVRTNPL----HWTSWDV 1307
            ..:||...|....|| |:..||...     :|...| |:..|.. |..|...|.    .|::.:|
Human   691 GAREEPTVQQAQRRS-AVFLSFKSP-----IPCLPLRWEQQSKL-LPTVAGIPASKVSKWSTDEV 748

  Fly  1308 CEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIA 1366
            .|:|:......:..||..::.|||.|.|::.:.::...:.:|:|||:|:::.||..:.|
Human   749 SEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAA 807

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 51/98 (52%)
MBT 929..1028 CDD:214723 48/100 (48%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377 25/92 (27%)
L3MBTL3XP_006715639.1 MBT 271..367 CDD:214723 51/97 (53%)
MBT 380..474 CDD:214723 47/97 (48%)
MBT 486..578 CDD:214723 41/92 (45%)
zf-C2HC 592..619 CDD:279824 10/28 (36%)
SAM 740..806 CDD:197735 18/66 (27%)
SAM_Scm-like-3MBT3,4 740..805 CDD:188981 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87253353
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H18226
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 1 1.000 T609620
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.672 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.