DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3MBTL2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_113676.2 Gene:L3MBTL2 HGNCID:18594 Length:705 Species:Homo sapiens

Alignment Length:793 Identity:167/794 (21%)
Similarity:285/794 (36%) Gaps:251/794 (32%)


  Fly   621 PKLADPKPSSPPAKNAKKANDHDA------------NPSPSSKTNDFKKSMMQNLNMLKWRGQQP 673
            |:..:..|||.|   .::..|.|.            |.|..|:::.:.:...:..|..:..|:.|
Human     4 PRSIEETPSSEP---MEEEEDDDLELFGGYDSFRSYNSSVGSESSSYLEESSEAENEDREAGELP 65

  Fly   674 ANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGP 738
            .:.              |.:.....||.          .|..|..|:        :|:.|...|.
Human    66 TSP--------------LHLLSPGTPRS----------LDGSGSEPA--------VCEMCGIVGT 98

  Fly   739 AADFLA--PHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKS-- 799
            ...|.:  ..||||.|     .|....:::|.|.::|.|     |..|  .:|.:..:|...|  
Human    99 REAFFSKTKRFCSVSC-----SRSYSSNSKKASILARLQ-----GKPP--TKKAKVLHKAAWSAK 151

  Fly   800 LSAIQEQLQQRQ--------KDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEI--GM 854
            :.|........|        :|.....|.|.::||..... |||:..|.: .|:.....::  ||
Human   152 IGAFLHSQGTGQLADGTPTGQDALVLGFDWGKFLKDHSYK-AAPVSCFKH-VPLYDQWEDVMKGM 214

  Fly   855 KLEAIDPE---NCSLFCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARV 914
            |:|.::.:   ...::.:.|:::..|||:.|.::|:  .:.:|||.|..:.|:.|.|||...:::
Human   215 KVEVLNSDAVLPSRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKI 279

  Fly   915 LQAPKDYNSERFSWSRYLVK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKI 977
            |..|:..:::...|..||:|  .|.:..|  :..|:.|.:.|  :..|..||.||..|.:...:.
Human   280 LVPPRTIHAKFTDWKGYLMKRLVGSRTLP--VDFHIKMVESM--KYPFRQGMRLEVVDKSQVSRT 340

  Fly   978 CVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW------------------------- 1017
            .:|.|..::..|:|:.::..|...|.|.|:.||.|||.||                         
Human   341 RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRK 405

  Fly  1018 -----------------------HEGRQ------------------------------------- 1022
                                   .||.:                                     
Human   406 IYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDGGPSTD 470

  Fly  1023 -------------------------QLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPME- 1061
                                     :|..|..|:...|.|::|:.:....||...||....|.. 
Human   471 GLDWFCYHASSHAIFPATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHG 535

  Fly  1062 YQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHE 1126
            ::..||||.||...|.||..|||.......:.:|.|.|.:||..|::.:|||::|:||||.|.::
Human   536 FKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQ 600

  Fly  1127 LETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPEN 1191
            |: ||...:|.:.:..                     :|......:.:.:.| |.:.|.:..|  
Human   601 LQ-PPVAAEPATPLKA---------------------KEATKKKKKQFGKKR-KRIPPTKTRP-- 640

  Fly  1192 IRRGWAKKTKRACSEAKQAIKEDSQQ------------EIVYPKVAE----VVQAKRKTSPCEEK 1240
            :|:|           :|:.:.||..|            ||:..:|.|    |....:.:||  |.
Human   641 LRQG-----------SKKPLLEDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSP--EL 692

  Fly  1241 VVKKQKQMQKEED 1253
            .|..:...|:.:|
Human   693 PVSVENIKQETDD 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 27/103 (26%)
MBT 929..1028 CDD:214723 33/211 (16%)
MBT 1038..1130 CDD:214723 34/93 (37%)
SAM_PNT 1279..1366 CDD:280377
L3MBTL2NP_113676.2 MBT 1 179..283 29/106 (27%)
MBT 183..283 CDD:214723 27/102 (26%)
MBT 2 291..391 30/104 (29%)
MBT 294..390 CDD:214723 29/100 (29%)
MBT 3 397..500 3/103 (3%)
MBT 408..500 CDD:214723 3/92 (3%)
MBT 4 508..604 37/97 (38%)
MBT 511..604 CDD:214723 35/94 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.