DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and PHC3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005247846.1 Gene:PHC3 HGNCID:15682 Length:1011 Species:Homo sapiens

Alignment Length:1238 Identity:220/1239 (18%)
Similarity:392/1239 (32%) Gaps:377/1239 (30%)


  Fly   268 NHVKKLLTSPNP--SGEDKTRSTQKNNKQNTSASQL-KPVVA--------------------PKT 309
            :|...:.|.|||  |....|.|:.......||:|:: :|.::                    |.:
Human     8 DHSTAMDTEPNPGTSSVSTTTSSTTTTTITTSSSRMQQPQISVYSGSDRHAVQVIQQALHRPPSS 72

  Fly   310 AMPIATEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAVAPVVTSPEKVDVKPT-------- 366
            |.....::..|....:.|   ...|::...|.|.:...:.||...::| .:....||        
Human    73 AAQYLQQMYAAQQQHLML---HTAALQQQHLSSSQLQSLAAVQASLSS-GRPSTSPTGSVTQQSS 133

  Fly   367 -AKPSIKTAPKPTPKPL------EMSVNGPAKEKKAPAKEQKQKTM----DKPPVVKEIAQ---- 416
             ::.||..:..|||..|      ..|.:|..          .|:||    ..|.:....||    
Human   134 MSQTSINLSTSPTPAQLISRSQASSSTSGSI----------TQQTMLLGSTSPTLTASQAQMYLR 188

  Fly   417 -----HTPCG-----PKELPKLKRSKSFVSNHPASPVAN-NERRHSVAIMAKEVDVIEQPSAAIE 470
                 .||..     ..::|.:..|.|......|:.|.| ..|...:.:::...:...:.::..:
Human   189 AQMLIFTPATTVAAVQSDIPVVSSSSSSSCQSAATQVQNLTLRSQKLGVLSSSQNGPPKSTSQTQ 253

  Fly   471 TITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKKKQIPMPILPAGITISTTSTAKKKAVRKN 535
            ::||..:..:....:..:...:|:.|:|.|                     |.:..::..||.:.
Human   254 SLTICHNKTTVTSSKISQRDPSPESNKKGE---------------------SPSLESRSTAVTRT 297

  Fly   536 SSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDFERSLRCDEQVPQT 600
            ||:..:.:    .:|||.::              |. |:||.:.:||                .:
Human   298 SSIHQLIA----PASYSPIQ--------------PH-SLIKHQQIPL----------------HS 327

  Fly   601 PPKSSSSSSSGSH-------ASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKS 658
            ||      |..||       ..:...|..|.:.....||:::.....:|...|:||:..:.....
Human   328 PP------SKVSHHQLILQQQQQQIQPITLQNSTQDPPPSQHCIPLQNHGLPPAPSNAQSQHCSP 386

  Fly   659 MMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACV 723
            :..:.:.|.....|..:.|.|.|                         ...|....|.:.|:..:
Human   387 IQSHPSPLTVSPNQSQSAQQSVV-------------------------VSPPPPHSPSQSPTIII 426

  Fly   724 HPLLYLCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAP-DLP 787
            ||              ...:.||            ..:..:.|....:.::...|...||. :||
Human   427 HP--------------QALIQPH------------PLVSSALQPGPNLQQSTANQVQATAQLNLP 465

  Fly   788 QKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIH-----LFLNPFPISP 847
            ........|...:..:|:..                 |.|.|:.:.:|.|     |..:|.||: 
Human   466 SHLPLPASPVVHIGPVQQSA-----------------LVSPGQQIVSPSHQQYSSLQSSPIPIA- 512

  Fly   848 NCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETA 912
                        .|...|......|..:          ...||....|   ..:|...|      
Human   513 ------------SPPQMSTSPPAQIPPL----------PLQSMQSLQV---QPEILSQG------ 546

  Fly   913 RVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKI 977
            :||......:.|....:..||:...:..|......:|:|.|........|||||....|:....:
Human   547 QVLVQNALVSEEELPAAEALVQLPFQTLPPPQTVAVNLQVQPPAPVDPPVGMHLNQCHLHKVFSL 611

  Fly   978 CVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGR-----------QQLIVPPDYQ 1031
            .|..|.|:.:|.:.   :..|:|..:......|.:.|.....||           :|:.:|....
Human   612 KVYQVEDVCEEEMP---EESDECVRMDRTPPPPTLSPAAITVGRGEDLTSEHPLLEQVELPAVAS 673

  Fly  1032 KSAFIWDDYISEVGGMAASKELFTPRQPM----------EYQERMKLEVVDQRNPCLIRPATVVT 1086
            .||       |.:...:....:..|..|:          .......:..::.:.|..|....::|
Human   674 VSA-------SVIKSPSDPSHVSVPPPPLLLPAATTRSNSTSMHSSIPSIENKPPQAIVKPQILT 731

  Fly  1087 R--KGYRVQLHLDCWPTEYYFWLEDDSPDLHPI-------GWC---------------------- 1120
            .  :|:.:|..|:.:|......|.:......|:       ..|                      
Human   732 HVIEGFVIQEGLEPFPVSRSSLLIEQPVKKRPLLDNQVINSVCVQPELQNNTKHADNSSDTEMED 796

  Fly  1121 ---EATSHELETPPGYLQPKSVMPCDVEGCRGFGN-------------AKRFNLNVHALRECC-P 1168
               |.|..|:::        .::.|:..|..|:.|             |||:|::      |. .
Human   797 MIAEETLEEMDS--------ELLKCEFCGKMGYANEFLRSKRFCTMSCAKRYNVS------CSKK 847

  Fly  1169 YAPENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKED--SQQEIVYPKVAEVVQAK 1231
            :|...|.:           .|:|...|   ...|..|....|.:|.  .|..|.||...|.:.:.
Human   848 FALSRWNR-----------KPDNQSLG---HRGRRPSGPDGAAREHILRQLPITYPSAEEDLASH 898

  Fly  1232 RKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVR 1296
            ..:.| .....:.::|.::|.:.|              ::|...:.:|.      ||.. |...:
Human   899 EDSVP-SAMTTRLRRQSERERERE--------------LRDVRIRKMPE------NSDL-LPVAQ 941

  Fly  1297 TNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLIL 1361
            |.|..||..||..:|.......|||.....|:|||:|||:|....|.:.:.:|:|||:|:.:.|.
Human   942 TEPSIWTVDDVWAFIHSLPGCQDIADEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKICARIN 1006

  Fly  1362 NLR 1364
            :|:
Human  1007 SLK 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 19/101 (19%)
MBT 929..1028 CDD:214723 24/110 (22%)
MBT 1038..1130 CDD:214723 16/136 (12%)
SAM_PNT 1279..1366 CDD:280377 30/87 (34%)
PHC3XP_005247846.1 SAM_Ph1,2,3 942..1010 CDD:188976 26/69 (38%)
SAM 944..1011 CDD:197735 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.