DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and scml2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_012812742.1 Gene:scml2 XenbaseID:XB-GENE-6043728 Length:706 Species:Xenopus tropicalis

Alignment Length:752 Identity:166/753 (22%)
Similarity:253/753 (34%) Gaps:260/753 (35%)


  Fly   807 LQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFCVCS 871
            ::...|...::.|.|.:||...| .||||.:.|........|.|::||||||.||.|.:..|:.:
 Frog     2 MKSNTKKTAKEKFNWDDYLNQVG-SVAAPPNCFKQSRTPPSNDFKVGMKLEAHDPRNITSICIAT 65

  Fly   872 IVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKT- 935
            :|.:.|.||:|..||.....|||...||.||...|.|::...:||.|..:.....||..:|:|| 
 Frog    66 VVGITGARLRLRLDGSDDKNDFWRLVDSCDIQQIGTCEKKGDMLQPPLGFRMNASSWPMFLLKTL 130

  Fly   936 -GGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDD 999
             |...||...|   ..:.|...::.|..||.|||.|..:...||.||:.|:..:.|.:.||||..
 Frog   131 NGADMAPITCF---KQEPQKPSQSFFKTGMKLEAVDKKNPYLICPATIGDVKGDDIFITFDGWRG 192

  Fly  1000 CYDLWVHITSPYIHPCGWHEGRQQLIVPPDYQKS---------AFIWDDYISEVGGMAASKELFT 1055
            .:|.|....|..|.|.||.......:.||....|         |       |.:.|:..|.:  :
 Frog   193 AFDYWCKYDSRDIFPIGWCSLTGDSLQPPGNSVSLPRTSSTPTA-------SPIKGVRRSMQ--S 248

  Fly  1056 PRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPD------- 1113
            |::|::.|:..|    ..|:.|| ...:...|||.|.:          ...|..::|:       
 Frog   249 PQKPVQAQKGRK----PMRDKCL-GQTSASPRKGKRPK----------NTTLSRNTPNAENQTKS 298

  Fly  1114 -------------------LHPIGWCEATSHE----------LETPPG----------------- 1132
                               |.|:...:..|::          |.:|..                 
 Frog   299 KGTGLKPGRKKETLALNSSLPPVNTSDGDSNKSQILKDGVGILGSPVAVISTVCVYVNKHGNSGP 363

  Fly  1133 YLQPKSVM---------PCD------VEGC-------------------------RGFGNAKRFN 1157
            :|..|.|:         |.:      |:.|                         ..|...|.  
 Frog   364 HLDKKKVLQLPDHFGPGPVNVVLQQAVQACVDCAYYSKIVFSFLKSGHHGGEAITASFDGEKH-- 426

  Fly  1158 LNVHA------------LRECC------------PYAPENWRQW------RSKTVKPPRVAPENI 1192
             :||.            |.:.|            |::|......      ||||.|      |.|
 Frog   427 -SVHLPPVNSASFVLRFLEKLCHSLQCDNLFSSQPFSPHMGGAHSPTDYDRSKTTK------EEI 484

  Fly  1193 RRGWAKKTKRACSEA---KQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQMQKEE-- 1252
            .   .:..||.|.:.   ...:.....:..|:|..||:       ||.||..:.|.::..:|.  
 Frog   485 T---DRSNKRYCQDPPPFSAPLSPKLPRSEVHPPEAEM-------SPTEENCMPKDQRFSEESMD 539

  Fly  1253 ------------------------------------------------------------DAEQV 1257
                                                                        |:.:.
 Frog   540 SALNTVNTASPATRNTTEYRNMGATSAYYRGSVQPVTATSNGAPVVRRSSSSSASNSCYYDSSRN 604

  Fly  1258 PDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDI-- 1320
            ..:|.:..|.|..   ||:.....|  |...:...|     |..|:..||..:::.| |...:  
 Frog   605 RTQRRIEAASSTT---GPELHSTER--QTTQSLSKD-----PATWSVDDVMRFVKEA-DPQALAP 658

  Fly  1321 -AKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
             |::....:|||.|||:|....:..|:.||:|||:||
 Frog   659 HAELFRRHEIDGTALLLLRSDMIMKYMGLKLGPALKL 695

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 38/96 (40%)
MBT 929..1028 CDD:214723 33/101 (33%)
MBT 1038..1130 CDD:214723 20/128 (16%)
SAM_PNT 1279..1366 CDD:280377 25/82 (30%)
scml2XP_012812742.1 MBT 17..112 CDD:214723 38/96 (40%)
MBT 123..221 CDD:214723 33/101 (33%)
DUF3588 350..459 CDD:288954 12/112 (11%)
SAM_Scm 633..704 CDD:188977 23/70 (33%)
SAM 636..704 CDD:197735 22/62 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87425372
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.