DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Samd7

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_083765.2 Gene:Samd7 MGIID:1923203 Length:445 Species:Mus musculus

Alignment Length:342 Identity:81/343 (24%)
Similarity:130/343 (38%) Gaps:79/343 (23%)


  Fly  1130 PPGYLQPKSVMPC-DVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQ-WRSKT----VKPPRVA 1188
            |.|: |.:|.:|. ||...|......:.|..:.|.|   |:..|.|.| :|.:.    .|||...
Mouse   140 PTGF-QGRSTLPASDVHLHRSTFRHLQGNPILLATR---PHFTECWGQKYRLRRGAVYQKPPESD 200

  Fly  1189 PENIRRGWAKKTKRACS----EAKQAIKE-----DSQQEIVYPKVAEVVQAKRKTSPCEEKVVKK 1244
            .|:.:....:|:.....    |.::.||:     |:||:   |:||:........:|..|....:
Mouse   201 TESFKSQAEEKSSSQMPTLSYEEEEYIKDPDIEVDNQQK---PRVADGKPTTVPANPHGELHTHQ 262

  Fly  1245 QKQMQKE----EDAEQVPDE-------------RSLAIARSFVKDYGPQFLP---NYRLWQLNSA 1289
            :|....|    :|.:..|.|             |.::|            ||   .:....|...
Mouse   263 RKPSSLEANAWDDGKGKPSEQVYEGCDGKNGVFRPVSI------------LPLSGTHEQVALREN 315

  Fly  1290 FKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAV 1354
            ..|.|::    .||..||..:|......:|.|:|..:..|||..|.:|..:.|...:.||:|||:
Mouse   316 CSLSDIQ----KWTVDDVYNFIRSLPGCSDYAQVFKDHAIDGETLPLLTEQHLRGTMGLKLGPAL 376

  Fly  1355 KLYSLILNLRIAVVCKFDSKNIELESNTAGPIQREMDTPVSAIKQLPEQSQTNGYKTDHDQELSE 1419
            |:.|.:......:.||   |...|.::.    ::..|.|......|...|.::|        ||.
Mouse   377 KIQSQVSQHVGNMFCK---KLPSLPTHA----RQAFDQPADTSPLLDMSSWSDG--------LSI 426

  Fly  1420 SGDDD------DDEDVM 1430
            .|..|      .::|||
Mouse   427 PGPQDLLSPKRTEQDVM 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723 81/343 (24%)
SAM_PNT 1279..1366 CDD:280377 25/90 (28%)
Samd7NP_083765.2 SAM_Samd7,11 321..388 CDD:188978 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87204485
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.