DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and L3mbtl4

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_008765658.2 Gene:L3mbtl4 RGDID:1587524 Length:296 Species:Rattus norvegicus

Alignment Length:250 Identity:84/250 (34%)
Similarity:121/250 (48%) Gaps:39/250 (16%)


  Fly   732 RCNFHGPAADFLAPHFC-SVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDL--------- 786
            :|.:...|:...|...| :||  ||:::.|...:..:..:..|.:....||....|         
  Rat    32 KCGWGTEASPGKARTACHAVG--RRARQVRQEHARARRGRFPRPRPVHLAGRQWLLRGSGKTLLR 94

  Fly   787 ---PQKRQTNYKPHKSLSAIQEQLQQ------RQKDKP---------------RKPFRWSEYLKS 827
               .:.||.|.|...|:::.:...|.      .::.||               ::.:.|.:||: 
  Rat    95 NSEVEMRQPNRKRKLSMASTEHMNQDGRMGQTEEETKPGDGATPSGRESSVTTQETWSWEQYLR- 158

  Fly   828 KGKDVAAPIHLFL--NPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSM 890
            :|..||||:.||.  ..||...|.|::||:||.||....|:|||.|:.||.||||:|.||||.|.
  Rat   159 EGNAVAAPVELFSKDQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDGYLSC 223

  Fly   891 YDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALF 945
            ||||.||.|.||.|.|||.:|...|..|:||..::|.|..||.....:.||:.||
  Rat   224 YDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLF 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 51/98 (52%)
MBT 929..1028 CDD:214723 6/17 (35%)
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
L3mbtl4XP_008765658.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.