DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Mbtd1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_017453183.1 Gene:Mbtd1 RGDID:1592427 Length:695 Species:Rattus norvegicus

Alignment Length:742 Identity:169/743 (23%)
Similarity:248/743 (33%) Gaps:295/743 (40%)


  Fly   604 SSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKSMMQNLNMLKW 668
            |.|..:|.|.:||.|                      :.:|.|.|:            ||.::|.
  Rat    42 SCSEDTSSSSSSEES----------------------EEEAAPLPA------------NLPIIKN 72

  Fly   669 RGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRC 733
            .||                                       :|..|..:..      :..|:.|
  Rat    73 NGQ---------------------------------------VYTYPDGKSG------MATCEMC 92

  Fly   734 NFHGPAADFLA--PHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKP 796
            ...|....|.:  ..||||.|     .|....:::|.|.::|.|:               |...|
  Rat    93 GMVGVRDAFYSKTKRFCSVSC-----SRSYSSNSKKASILARLQV---------------TGKPP 137

  Fly   797 HKSLSAIQEQ---------------LQQRQKDKPR------KPFRWSEYLKSKGKDVAAPIHLFL 840
            .|....:|:|               ||.:.|.|..      :.|.|..|:.| ...:|||:..|.
  Rat   138 TKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSAISVEGFSWGNYINS-NSFIAAPVACFK 201

  Fly   841 N-PF-----PISPNCFEIGMKLEAIDPENCSL----FCVCSIVEVRGYRLKLSFDGY--SSMYDF 893
            : |.     .||.|     :::| :...:|||    |.:..|:::.||...|.::|:  .|..||
  Rat   202 HAPMGTCWGDISEN-----VRIE-VPNTDCSLPTKVFWIAGIIKLAGYNALLRYEGFENDSSLDF 260

  Fly   894 WVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAP--------------- 941
            |.|....||.|.|||..:.:.|..|:....:..:|..:|||  ||.|..|               
  Rat   261 WCNICGSDIHPVGWCAASGKPLVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFPQKVSESMQYPF 325

  Fly   942 -------------------------------------------------RALFGHLNMQQQMDVR 957
                                                             ..|..|:...:.:..|
  Rat   326 KPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHR 390

  Fly   958 -------------------------------NGFAVGMHLEAEDLNDTGKICVATVTDIL-DERI 990
                                           ..|..||.|||.|..:...|||||:..:| |..:
  Rat   391 FKRSDITKKQDGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFL 455

  Fly   991 RVHFDG--------WDDCYDLWVHITSPYIHPCGWHEGRQQLIVPP-DYQKSAFIWDDYISEVGG 1046
            .:..||        | .||    |.|||.|.|.|:.|.....:.|| .|.|..|.|.||:.|.|.
  Rat   456 MIGIDGSEAADGSDW-FCY----HATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGS 515

  Fly  1047 MAASKELFTPRQPME-YQERMKLEVVDQRNPCLIRPATVVTRKGYR-VQLHLDCWPTEYYFWLED 1109
            :||..:||....|.. ::..||||.||...|.||..|| |||..:| :::|.|.|..||..|::.
  Rat   516 IAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLICVAT-VTRIIHRLLRIHFDGWEEEYDQWVDC 579

  Fly  1110 DSPDLHPIGWCEATSHELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENW 1174
            :||||:|:|||:.|.::|:.|                                       |.::.
  Rat   580 ESPDLYPVGWCQLTGYQLQPP---------------------------------------ASQSS 605

  Fly  1175 RQWRSKTVKPPRVAPENIRRGWAKKTK 1201
            |:.:|.:.|..:.|.....:|..||.|
  Rat   606 RESQSASSKQKKKAKSQQYKGHKKKRK 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 32/108 (30%)
MBT 929..1028 CDD:214723 38/205 (19%)
MBT 1038..1130 CDD:214723 40/94 (43%)
SAM_PNT 1279..1366 CDD:280377
Mbtd1XP_017453183.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.