DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Samd1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001074884.1 Gene:Samd1 MGIID:2142433 Length:519 Species:Mus musculus

Alignment Length:320 Identity:68/321 (21%)
Similarity:113/321 (35%) Gaps:106/321 (33%)


  Fly  1122 ATSHELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPY----APENWRQWRSKTV 1182
            |...:.:.||...||    |.:....|..|.|:..     :|||...|    ...:.|..|.:. 
Mouse   200 APPQQQQPPPPQPQP----PPEGGAARAGGPARPV-----SLREVVRYLGGSGGASGRLTRGRV- 254

  Fly  1183 KPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQKQ 1247
              ..:..|...||..::|:...    .|:....:.....|  |...:|.|.....||:|.:|:::
Mouse   255 --QGLLEEEAARGRLERTRLGA----LALPRGDRPGRAPP--AASARAARSKRGGEERVFEKEEE 311

  Fly  1248 MQKEEDAE----------QVPD--------------ERSLAIARSFVKDYGP------------- 1275
            .:.|::.|          :||:              ||....|:..||::.|             
Mouse   312 DEDEDEEEEEEDNVSEGSEVPESDRPAGAQHHQINGERGPQSAKERVKEWSPCGPYQGQDEGRGP 376

  Fly  1276 -------QFLPNYRLWQLN--------------------------------SAFKLDDVR----T 1297
                   |..|   :..:|                                :.|.....|    |
Mouse   377 APGSCTRQVFP---MTAVNKEGGSACVGAAPDSPSPVPLPPGKPALPGADGTPFGCPPGRKEKPT 438

  Fly  1298 NPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLY 1357
            :|:.||..||.||...| ...:.|....||:|||::||::.|.::.|.|.:::|||:|:|
Mouse   439 DPVEWTVMDVVEYFTEA-GFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIY 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723 1/8 (13%)
SAM_PNT 1279..1366 CDD:280377 29/116 (25%)
Samd1NP_001074884.1 SAM_Atherin-like 440..508 CDD:188982 24/60 (40%)
SAM 440..506 CDD:197735 24/60 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.