DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Sfmbt1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_113835.2 Gene:Sfmbt1 RGDID:61999 Length:863 Species:Rattus norvegicus

Alignment Length:897 Identity:169/898 (19%)
Similarity:275/898 (31%) Gaps:399/898 (44%)


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAI---DPENCSLFCVCSIVEVRGYRL 880
            |.|.:||:..|. ..||...|.:......:.|..|||||..   |||.   :.|.:::......|
  Rat    20 FSWEDYLEETGA-TTAPYASFKHVDICLQSGFAPGMKLEVALRKDPET---YWVATVITACEQLL 80

  Fly   881 KLSFDGYSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAP 941
            .|.::||..  ..|||.:.....::|.|||.:..:.|:||:....:...||.:|.:  ||....|
  Rat    81 LLRYEGYGEDRKADFWCDIRRAGLYPIGWCQQNKKTLEAPEGIRDKVSDWSAFLQRTLTGACGPP 145

  Fly   942 RALF-GHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWD--DCYDL 1003
            .||. |..|.:..:|:   .|.|..||.:|..|:....:.||.:.:..|:::.::|.:  |.::.
  Rat   146 VALLEGLRNGRNPLDL---IAPGSRLECQDFRDSVSTWIVTVVENIGGRLKLQYEGLERHDGFEH 207

  Fly  1004 WVHITSPYIHPCGW-------------------------------------------------HE 1019
            |::...|::|..||                                                 ||
  Rat   208 WLYYLDPFLHHIGWAAQQGYELQPPLAIRHLKNEADWQEILARVKEEEPLPSYLFKDKQVIRTHE 272

  Fly  1020 --------------------------------------------GRQQLIV-------------- 1026
                                                        .|:..:.              
  Rat   273 FSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEIDDLRPEDHARRSFVCHANSPGIFPVQWSL 337

  Fly  1027 --------PPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQ--ERMKLEVVDQRNPCLIRP 1081
                    ||.::...|.|.||:.:.|..||.::.| |:...|:|  |.||||.|:...|..:..
  Rat   338 KNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCF-PQSVSEHQFKENMKLEAVNPLFPEEVSI 401

  Fly  1082 ATVVTRKGYRVQLHLDCWPTEYYFWLE--------------DDSPDLHPIGWCEATSHELETPP- 1131
            |||...:|             .|.||:              .:|.::.|:||||...|.|.||. 
  Rat   402 ATVTAVRG-------------SYLWLQLEGSKKPVPEFIVSVESMNIFPLGWCETNGHPLSTPRR 453

  Fly  1132 ---------GYLQPK---------------------SVM-------------------P------ 1141
                     ..:||:                     |||                   |      
  Rat   454 ARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSPHSVMINGKYCCPKIYFNHRCFSGPYLNKGR 518

  Fly  1142 -CDVEGCRGFGN----------------------------------------------AKRFNLN 1159
             .::..|.|.||                                              .|.:...
  Rat   519 IAELPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKGKSYRAT 583

  Fly  1160 VHALR----------------ECCP--YAP--------EN------------WRQWRSKTVKPPR 1186
            |..:|                ||||  :.|        ||            :.:.::|.:..|.
  Rat   584 VEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648

  Fly  1187 VAPENIRRGWAKKTKR------------------------------------------------- 1202
            ....|:.....|.:||                                                 
  Rat   649 GGHSNLSCALKKTSKRRKRRKNIFVHKKKRSSASVDNTPVGSPQGSGGEDEDDADDGDDDSLTEG 713

  Fly  1203 ACSEAKQAIKEDSQQEIVYPKVAEVVQAKRKTSPC------------EEKVVKKQKQMQKEEDAE 1255
            :.||.:..:.|:|:           |..|:..||.            :.:..|::.|.....|.|
  Rat   714 STSEQQDELHEESE-----------VSEKKSCSPSPTQSEMSTPLPPDTQTDKREAQTSSLSDGE 767

  Fly  1256 -QVPDERSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTD 1319
             :.|..:.:.|                   :::....||   :|||.|:..||..:| |:.|...
  Rat   768 NKPPSPKEIRI-------------------EVDERLHLD---SNPLKWSVADVVRFI-RSTDCAP 809

  Fly  1320 IAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKF 1371
            :|::..:|:|||:|||:|....:...:.||:|||:||...|..::.|...:|
  Rat   810 LARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQF 861

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 29/101 (29%)
MBT 929..1028 CDD:214723 30/219 (14%)
MBT 1038..1130 CDD:214723 32/108 (30%)
SAM_PNT 1279..1366 CDD:280377 28/87 (32%)
Sfmbt1NP_113835.2 MBT 1 20..120 31/104 (30%)
MBT 23..120 CDD:214723 29/101 (29%)
MBT 2 128..232 27/107 (25%)
MBT 138..232 CDD:214723 24/97 (25%)
MBT 3 242..346 3/104 (3%)
MBT 252..346 CDD:214723 3/94 (3%)
MBT 4 354..451 34/111 (31%)
MBT 358..451 CDD:214723 32/107 (30%)
DUF3588 499..614 CDD:288954 13/115 (11%)
SAM_Scm-like-4MBT1,2 779..863 CDD:188980 30/88 (34%)
SAM 790..854 CDD:197735 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87288777
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.