DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and SFMBT2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001018049.1 Gene:SFMBT2 HGNCID:20256 Length:894 Species:Homo sapiens

Alignment Length:931 Identity:194/932 (21%)
Similarity:299/932 (32%) Gaps:362/932 (39%)


  Fly   763 QSTQKESKI---SRTQLEQTAGTA---PDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRW 821
            :||...|.:   |.:.||:..|:|   .||..:..         |:::|           ..|.|
Human     2 ESTLSASNMQDPSSSPLEKCLGSANGNGDLDSEEG---------SSLEE-----------TGFNW 46

  Fly   822 SEYLKSKGKDVAAPIHLFLNPFPIS-PNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFD 885
            .|||:..|.. ||| |.......|| .:.|:.|||||..:..|...:.|.:|:...|..|.|.:.
Human    47 GEYLEETGAS-AAP-HTSFKHVEISIQSNFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYC 109

  Fly   886 GYSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALF- 945
            ||..  ..|||.:....|:.|.|||.:..:||..|.....:...|:.:|::  ||.:.||..|. 
Human   110 GYGEDRRADFWCDVVIADLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLE 174

  Fly   946 GHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDD--CYDLWVHIT 1008
            |.|..:..:|:   ..||..:|.:|..:..:..:.:|.:.:..|:|:.:.|.:|  .||.|:...
Human   175 GPLRGKGPIDL---ITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYL 236

  Fly  1009 SPYIHPCGWHEGRQQLIVPPD-------------------------------------------- 1029
            ...:.|.||.:..:..:.||.                                            
Human   237 DYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFT 301

  Fly  1030 ----------------------------------------------------------------- 1029
                                                                             
Human   302 VGMKLETVNMCEPFYISPASVTKVFNNHFFQVTIDDLRPEPSKLSMLCHADSLGILPVQWCLKNG 366

  Fly  1030 --------YQKSAFIWDDYISEVGGMAASKELFTPRQ-PMEYQERMKLEVVDQRNPCLIRPATVV 1085
                    |....|.|.||..:.|...|....|.... ...:.:.||||.|:.|||..:..|:||
Human   367 VSLTPPKGYSGQDFDWADYHKQHGAQEAPPFCFRNTSFSRGFTKNMKLEAVNPRNPGELCVASVV 431

  Fly  1086 TRKGYRVQLHLDCWPTEYYFWLED-DSPDLHPIGWCEATSHELETPP----------GYLQPKSV 1139
            :.||..:.|||:...|.....:.| :|.|:.|:|||||.|:.|..|.          ..:||:..
Human   432 SVKGRLMWLHLEGLQTPVPEVIVDVESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAVVQPEKQ 496

  Fly  1140 MPCDV-------EGC-------RGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVA-- 1188
            :|..|       :.|       .|..|.|          .|||....|.|.:....:...|:|  
Human   497 LPPTVPVKKIPHDLCLFPHLDTTGTVNGK----------YCCPQLFINHRCFSGPYLNKGRIAEL 551

  Fly  1189 PENIRRG----------------------------------W--------AK---KTKRA----- 1203
            |:::..|                                  |        ||   ||.||     
Human   552 PQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQLVEDPHWNFQEETLKAKYRGKTYRAVVKIV 616

  Fly  1204 --------------------------------CSE--------------------AKQAIKEDSQ 1216
                                            |.|                    :|..|.| |.
Human   617 RTSDQVANFCRRVCAKLECCPNLFSPVLISENCPENCSIHTKTKYTYYYGKRKKISKPPIGE-SN 680

  Fly  1217 QEIVYPKVAE--------VVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKD- 1272
            .:..:||.|.        .||.||::|..:  ......:..:||||:.:.|:.:.....|.::| 
Human   681 PDSGHPKPARRRKRRKSIFVQKKRRSSAVD--FTAGSGEESEEEDADAMDDDTASEETGSELRDD 743

  Fly  1273 -------YGPQFLPNYRLWQLNSAFK-----------------------------------LDDV 1295
                   ..|...|. |...|.|..:                                   .:|.
Human   744 QTDTSSAEVPSARPR-RAVTLRSGSEPVRRPPPERTRRGRGAPAASSAEEGEKCPPTKPEGTEDT 807

  Fly  1296 R----------TNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKV 1350
            :          :|||.||..||..:| :..|...:||:..||||||:|||:|....:...::||:
Human   808 KQEEEERLVLESNPLEWTVTDVVRFI-KLTDCAPLAKIFQEQDIDGQALLLLTLPTVQECMELKL 871

  Fly  1351 GPAVKLYSLILNLRIAVVCKF 1371
            |||:||...|..:::|...::
Human   872 GPAIKLCHQIERVKVAFYAQY 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 34/99 (34%)
MBT 929..1028 CDD:214723 25/104 (24%)
MBT 1038..1130 CDD:214723 33/94 (35%)
SAM_PNT 1279..1366 CDD:280377 34/132 (26%)
SFMBT2NP_001018049.1 MBT 1 44..144 36/102 (35%)
MBT 48..144 CDD:214723 34/98 (35%)
MBT 2 152..256 26/107 (24%)
MBT 156..256 CDD:214723 25/103 (24%)
MBT 3 266..372 0/106 (0%)
MBT 276..372 CDD:214723 0/96 (0%)
MBT 4 380..477 35/97 (36%)
MBT 384..477 CDD:214723 33/93 (35%)
DUF3588 528..643 CDD:288954 15/115 (13%)
SAM_Scm-like-4MBT1,2 810..894 CDD:188980 30/85 (35%)
SAM 821..885 CDD:197735 28/65 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86669219
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.