DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and samd11

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_009295182.1 Gene:samd11 ZFINID:ZDB-GENE-060428-2 Length:874 Species:Danio rerio

Alignment Length:877 Identity:154/878 (18%)
Similarity:265/878 (30%) Gaps:283/878 (32%)


  Fly   691 LQINERCQPRQGPAAYFERPLYDRP-------GRRPS----------------------ACVHPL 726
            |.||:.||..:||:..: |..:..|       ||..:                      ..|||.
Zfish   107 LYINKLCQGSKGPSIKY-RTEWLTPNEFQFVSGRETAKDWKRSIRHKGKSLKTLMSKGILQVHPP 170

  Fly   727 LYLCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQ 791
            :..|..|....|           |...|.::||.:|                       ||..| 
Zfish   171 ICDCPGCRISSP-----------VNRGRLAEKRTIP-----------------------LPPTR- 200

  Fly   792 TNYKPHKSLSAI--------QEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPI----HLFLNPFP 844
               .|.|.|:::        .|:......|..::...::...||:..|::..|    |...:..|
Zfish   201 ---VPKKELASVFSSDDSEGSERASGDHADIKQEELNFTIMRKSRDSDLSTIISNLHHTRQHGMP 262

  Fly   845 ISPNCFEIGM----------KLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADS 899
            ...:|.::.:          |..|..| |.|..|.....:.|....|             .|:.:
Zfish   263 EGQSCSDLSLASAHTDDILGKRRAYSP-NSSSECPSDSKKSRSVSPK-------------ENSHT 313

  Fly   900 QDIFPPGWC---DETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFA 961
            ..:.|....   :...|::.|..::.|......|..........|.....|:..:..:.|||...
Zfish   314 PALEPGSHMTPEEHYRRMMSALNEHGSYEEQQQRLYQLANNMGIPSHELLHVRQEAMVAVRNPGG 378

  Fly   962 VGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYD-------------LWVHITSPYI- 1012
            :..|:.:     .|..........|.:....||...|..:.             |..|:..|:: 
Zfish   379 MEAHVPS-----AGSSSSQRRKQGLPQHRDAHFPERDISHPPPLLSPQNAPHIALGPHLRPPFLG 438

  Fly  1013 HPCGWHEGRQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPC 1077
            .|       ..|...|.|   .|:          ..|..|:|..:|          |::.::|..
Zfish   439 MP-------SALCQAPGY---GFL----------QPAQAEMFARQQ----------EILRKQNLA 473

  Fly  1078 LIRPATVVTRKGYRVQLH---LDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGY-----L 1134
            .:..:..:.|:.....||   |...|...:..|..:.|.|..:         .|.|.|:     |
Zfish   474 RLEMSAELLRQKELENLHRQRLLADPLGLHPGLPAEHPALRSL---------QEIPEGHPLREEL 529

  Fly  1135 QPKSVM-----------PCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVA 1188
            ..::.|           ..:.:|... |.:.:...|..:||:..|...:  :|..|...|     
Zfish   530 NRRNAMLVLRHNNTPLLSLNHQGAAA-GTSSKDLSNRKSLRKGGPLQGD--QQGGSSETK----- 586

  Fly  1189 PENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKRK-----------TSPCEEKVV 1242
             |.:|.|..:..:   :|......:||:.:      |||.:.:.:           :..|:.|.|
Zfish   587 -EMLREGCVRDVE---TEGMDEDMKDSEND------AEVGEDRPERLSKGDGHGLSSEVCQGKDV 641

  Fly  1243 KKQKQMQKE-------------EDAEQVPDER--SLAIARSFVKDYGP----------QFL---- 1278
            .|..:..||             ...::.|...  :..:.::..|...|          |.|    
Zfish   642 TKTSEAIKELGEGSGRLSVPCSSTGQESPTHHLFTSGLGKNEAKYLPPGIPPLPTLPGQMLPFTF 706

  Fly  1279 ----PNYRLWQLNSAF-------KLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGR 1332
                |.:....:...|       ..:|:.    .|:..:||.:|.......:..:|..||.|||.
Zfish   707 PYSSPYFHTGAMGGLFVDGEEAGAAEDIS----KWSVEEVCSFISSLAGCGEYTQVFREQAIDGE 767

  Fly  1333 ALLMLGRKELDTYLKLKVGPAVKLYSLILNL--RIAVVCKF--------------DSKNIELE-- 1379
            .|.:|....|...:.||:|||:|:.|.:...  ||..:..|              |...:..|  
Zfish   768 TLPLLTEDHLLNNMGLKLGPALKIRSQVARRIGRIFYMTSFPLALPLPPSALRPTDRDPLPTETR 832

  Fly  1380 ----SNTAGPIQREMDTPVSAIKQLPEQSQTN 1407
                |:|:.|    ...|..|.:..|:|...|
Zfish   833 PPSTSSTSSP----FSVPPPACRTSPKQENGN 860

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 19/113 (17%)
MBT 929..1028 CDD:214723 17/113 (15%)
MBT 1038..1130 CDD:214723 15/95 (16%)
SAM_PNT 1279..1366 CDD:280377 25/96 (26%)
samd11XP_009295182.1 SAND 93..165 CDD:279658 11/59 (19%)
SAM_Samd7,11 734..801 CDD:188978 20/71 (28%)
SAM 735..791 CDD:197735 19/60 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87351916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.