DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and l3mbtl2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_956326.1 Gene:l3mbtl2 ZFINID:ZDB-GENE-030131-8713 Length:805 Species:Danio rerio

Alignment Length:725 Identity:161/726 (22%)
Similarity:268/726 (37%) Gaps:215/726 (30%)


  Fly   686 NEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFLA--PHFC 748
            |:.||....:     .||.             :||:.|...:..|:.|...|....|.:  ..||
Zfish   142 NQHNFSDDGD-----NGPV-------------KPSSWVDDGIVACEMCGAVGSIDTFFSRTKRFC 188

  Fly   749 SVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTN-YKPHKSLSAIQEQLQQRQK 812
            |..|     .|....:::|.|.::|.|...:..::..|..|.||. .:|        :.::|.|:
Zfish   189 SASC-----SRSYSSNSKKSSILARLQGRPSKKSSHKLCPKTQTEVLRP--------KVIEQHQE 240

  Fly   813 DKP------RKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFE-----IGMKLEAIDPENC-- 864
            .:|      ...|.|..||:..|. :|||:..|.:    .|.|.:     :|:|:|.::....  
Zfish   241 SRPFVQDATLAGFDWGSYLEKSGL-LAAPVSCFRH----VPLCAQWEDVYVGLKVEVLNTHTALP 300

  Fly   865 -SLFCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERF 926
             .::.:.::|::.||:..|.::|:  ...:|.|.|..:.|:.|.|||....:.|..|::.:.:  
Zfish   301 SKVYWIATVVQLAGYKALLRYEGFEDDDRHDLWCNLGTADVHPIGWCAVNNKPLVPPQEVHQQ-- 363

  Fly   927 SWSRYLVK--TGGKAAP---------------------------------------------RAL 944
            .|..||::  .|....|                                             |.|
Zfish   364 DWKSYLMERLVGAHTIPVDFHVKMADSLRCPFRQGVRVEVVDRSQVSRTRLAVVDTVIGGRLRLL 428

  Fly   945 F------------------------GHLNMQQQMD---------VRNG----------------- 959
            :                        .|:...:.:|         |..|                 
Zfish   429 YEDAGLGPSGEVLSDFWCHMQSPLVHHVGWSETVDHSIKETDTNVNMGSHPAFRRVHQNSVPDQF 493

  Fly   960 ------------FAVGMHLEAEDLNDTGKICVATVTDI-LDERIRVHFDG--------WDDCYDL 1003
                        |..||.:||.|..:.|.||||:|..: ||..|.|..||        | .||  
Zfish   494 KKLRTVYMGATFFKEGMKIEAIDPLNLGNICVASVRKVLLDGYIMVGIDGVEIGDGSDW-FCY-- 555

  Fly  1004 WVHITSPYIHPCGWHEGRQ-QLIVPPDYQKSAFIWDDYISEVGGMAASKELF-TPRQPMEYQERM 1066
              |.:|..|.|.|:.|... .|.|||.|.::.|.|..|:.|.|.:||.:.|| |......:...|
Zfish   556 --HASSHAILPVGYCENNDIPLTVPPGYDQATFTWPVYLEETGAVAAPQRLFNTDDVGHGFTSGM 618

  Fly  1067 KLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPP 1131
            |||.||...|.|:..|||....|..:.||.|.|..|:..|::..||:::|:||||.|.::|:.|.
Zfish   619 KLEAVDLMEPRLVCVATVRRCVGRLLLLHFDGWEPEFDQWVDCQSPEIYPVGWCEITGYQLQPPI 683

  Fly  1132 GYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAPENIRRGW 1196
            |...|:.                  ..:.||.::..|:..:..|::..|..|.......|.....
Zfish   684 GPEPPQG------------------QEHSHASKKAKPFKGKRKRRFLRKNAKINLKTQTNENTEM 730

  Fly  1197 AKKTKRACSEAKQA---IKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQK--------QMQK 1250
            .:..:.|.:..|.:   ||.:.::|:    :|..|:.:...:|.......|:.        :.:|
Zfish   731 IQSQEAANTSDKPSTLQIKTEPEEEV----IAVRVKVEELETPILSSAQSKESHQGALTTFKREK 791

  Fly  1251 EEDAEQVPDE 1260
            ::|.::..||
Zfish   792 DDDEDEEEDE 801

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 26/106 (25%)
MBT 929..1028 CDD:214723 40/218 (18%)
MBT 1038..1130 CDD:214723 35/93 (38%)
SAM_PNT 1279..1366 CDD:280377
l3mbtl2NP_956326.1 THAP 4..89 CDD:283206
MBT 257..357 CDD:214723 26/105 (25%)
MBT 366..467 CDD:214723 8/101 (8%)
MBT 511..582 CDD:280910 29/76 (38%)
MBT 591..682 CDD:214723 35/91 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.