DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and mbtd1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005169539.2 Gene:mbtd1 ZFINID:ZDB-GENE-060810-138 Length:705 Species:Danio rerio

Alignment Length:763 Identity:178/764 (23%)
Similarity:280/764 (37%) Gaps:235/764 (31%)


  Fly   617 MSPPPKLADPKPSSPPAKNAKKAND------------HDANPSPSSK-TNDFKKSMMQNLNMLKW 668
            |..|..:|:..|     ::.:|..|            .|::.|.||: |.|...|:..:|.::|.
Zfish     1 MENPRDMAEHTP-----RSERKRRDSFGMFDGYDSCSEDSSSSSSSEDTEDEVPSIPASLPIIKN 60

  Fly   669 RGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRC 733
            .||                                       :|..|..:..      :..|:.|
Zfish    61 NGQ---------------------------------------VYTYPDGKAG------MATCEMC 80

  Fly   734 NFHGPAADFLA--PHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKP 796
            ...|....|.:  ..||||.|     .|....:::|.|.::|.|      ..|...:.:....:|
Zfish    81 GMVGVRDAFYSKTKRFCSVSC-----SRSYSSNSKKASILARLQ------GKPPTKKAKVLQKQP 134

  Fly   797 HKSLSAIQEQLQQRQKDK-------PRKPFRWSEYLKSKGKDVAAPIHLFLN-PFPISPNCFEIG 853
            ..:..|...|.|..|:::       |.:.|.|.:|:.|... |.||:..|.: |..:.......|
Zfish   135 LMAKLAAYAQYQASQQNQAKSKSVVPVEGFDWGQYICSNNL-VGAPVSCFKHVPMGMCWGDIAEG 198

  Fly   854 MKLEAIDPE---NCSLFCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETAR 913
            :::|..:.:   :..::.|..||::.|::..|.::|:  .|..|||.|....:|.|.|||..:.:
Zfish   199 LRVEVFNSDTNLSTKVYWVAEIVKLAGFKALLRYEGFDNDSSRDFWCNLCIPEIHPVGWCASSGK 263

  Fly   914 VLQAPKDYNSERFSWSRYLVK--TGGKAAP----------------------------------- 941
            .|..||....:..:|..:|||  ||.|..|                                   
Zfish   264 PLVPPKSIQHKYSNWKAFLVKRLTGAKTLPPEFATKVQENMQYPFKKLMRVEVVDKTHLCRTRVA 328

  Fly   942 ---RALFGHLNM-------------------------------------------QQQMDV---- 956
               :.:.|.|.:                                           :.|||.    
Zfish   329 LVEQVIGGRLRLVYEESQDGTDDFWCHMLSPLIHSIGWSRSIGHRFKRSEVSKKIEGQMDAPSQL 393

  Fly   957 --------RNG--FAVGMHLEAEDLNDTGKICVATVTDIL-DERIRVHFDG--------WDDCYD 1002
                    :||  |..||.|||.|..:...||||||..:| |..:.:..||        | .|| 
Zfish   394 FLKIKDVDQNGDWFKDGMKLEAIDPLNLSAICVATVRKVLADGYLMIGIDGSEAADGSDW-FCY- 456

  Fly  1003 LWVHITSPYIHPCGWHEGRQQLIVPP-DYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQER 1065
               |.|||.|.|.|:.|.....:.|| ...|..|.|.||:.|:|.:||..:||....|.. ::..
Zfish   457 ---HSTSPSIFPVGFCEINSIELTPPRGCTKLPFKWFDYLREIGSIAAPVKLFNKDVPNHGFRVG 518

  Fly  1066 MKLEVVDQRNPCLIRPATVVTRKGYR-VQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELET 1129
            ||||.||...|.|:..|| |||..:| :::|.|.|..||..|::.:||||:|||||:.|.::|:.
Zfish   519 MKLEAVDLMEPRLVCVAT-VTRIVHRLLRIHFDGWEDEYDQWVDCESPDLYPIGWCQLTGYQLQP 582

  Fly  1130 PPGYL---QPKSVMPCDVEGCRGFGNAKRFNLNV--------HALRECC-----PYAPENWRQWR 1178
            |....   .|.:|.....:..:..|..|:..:.|        ..||...     ...|.::....
Zfish   583 PAAQTTREAPPNVSKQKKKAAQYKGQKKKRKIPVGRRPIGLGGPLRRRSFSGDEEQTPPHYLSHF 647

  Fly  1179 SKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAE 1226
            |.:.:||....|        :.:...|||...:||::      |::.|
Zfish   648 SGSRRPPASGVE--------RDRSLNSEASLQVKEET------PEIDE 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 26/102 (25%)
MBT 929..1028 CDD:214723 43/205 (21%)
MBT 1038..1130 CDD:214723 40/94 (43%)
SAM_PNT 1279..1366 CDD:280377
mbtd1XP_005169539.2 MBT 169..268 CDD:214723 26/100 (26%)
MBT 285..375 CDD:214723 6/90 (7%)
MBT 384..479 CDD:214723 34/100 (34%)
MBT 491..583 CDD:214723 40/93 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.