DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and samd7

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005171361.1 Gene:samd7 ZFINID:ZDB-GENE-070912-549 Length:527 Species:Danio rerio

Alignment Length:174 Identity:47/175 (27%)
Similarity:76/175 (43%) Gaps:40/175 (23%)


  Fly  1274 GPQFLPNYRL--WQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLM 1336
            ||   ||..|  .:::|:   :|:|    .||..||..:|.......:.|:...|..|||..|.:
Zfish   372 GP---PNMFLNGEEMSSS---EDIR----KWTVDDVYSFISEIPSCAEYAQTFKEHMIDGETLPL 426

  Fly  1337 LGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKFDSKNIELESNTAGPIQREMDTPVSAIKQLP 1401
            |....|...|.||:|||:|:.|. |:.|:..:. ::..|:.|              |||.::..|
Zfish   427 LTEDHLLDTLGLKLGPALKIRSQ-LSRRLGNMF-YNMMNLPL--------------PVSGLQPPP 475

  Fly  1402 EQSQTNGYKTDHDQELSESGDDDDDEDVML----DSDDFLSVKP 1441
            |:|      .|...::|...:.:..|  ||    |:|...:.:|
Zfish   476 EKS------VDRSSDISSPLNCNSVE--MLSSPRDTDALKAAEP 511

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377 29/89 (33%)
samd7XP_005171361.1 SAM_Samd7,11 389..456 CDD:188978 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87199923
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.