DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and l3mbtl1b

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_009290632.1 Gene:l3mbtl1b ZFINID:ZDB-GENE-100922-38 Length:786 Species:Danio rerio

Alignment Length:813 Identity:241/814 (30%)
Similarity:356/814 (44%) Gaps:157/814 (19%)


  Fly   663 LNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPR------QGPAAYFERPLYDRP------ 715
            ::.|.|: ...|.|..|.:||.:.||..|:|....:|:      ..|......|:...|      
Zfish    19 MSALDWK-DGIATLPGSDIRFRMTEFGTLEIVTEAEPKIKETELTDPQPKITGPINRHPPDLNTT 82

  Fly   716 ---------------------------GRRPSACVHPLLYL--------------CQRCNFHGPA 739
                                       |...|...:|::..              |:.|...|..
Zfish    83 SNQTAKIQSNTDHQTSTPASTEPQRQAGGDSSTVDNPIINTVPNAIVPVTEAPINCRTCGLSGSR 147

  Fly   740 ADFLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQ 804
            ..||...|||..||:.|..|..|....:..::.:...:          :|:.......:....|:
Zfish   148 ESFLQGKFCSASCVQPSSGRSTPAEAFEGERLGKRVRK----------KKKMFMESEDEEEENIE 202

  Fly   805 EQLQQRQKDKPR----------------KPFRWSEYLKSKGKDVAAPIHLFL--NPFPISPNCFE 851
            |:.::.:..|.|                |.:.||.||:.: :..|||:.||.  ..||.|.|.|:
Zfish   203 EEEERVKSSKGRRAAKVARLVTAPLVKKKTWSWSVYLEEE-RAAAAPLKLFKEHQSFPQSRNGFK 266

  Fly   852 IGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQ 916
            :|||||.:||.:.:||||.::.||:|||::|.||||...|||||||||.|:.|||||::|:..|.
Zfish   267 VGMKLEGLDPCHPALFCVLTVAEVQGYRIRLHFDGYPECYDFWVNADSWDVKPPGWCEKTSLKLL 331

  Fly   917 APKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVAT 981
            .||......|:|:.|:....|:.||:.||..||...   ..:||..||.|||.|..:...|||||
Zfish   332 LPKGCRDGEFNWNTYVKNCRGQLAPKHLFKSLNTSV---TPSGFRAGMKLEAVDRKNLSDICVAT 393

  Fly   982 VTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-HEGRQQLIVPPDYQK-SAFIWDDYISEV 1044
            :...:|.|:.:|.|..||.:|.|...:||||||.|: .|.:..|..|.:|:. ..|.|:.|:.|.
Zfish   394 IAAAVDNRLLIHIDHCDDTHDYWCDASSPYIHPVGYCEEVKLTLTTPAEYKHLKGFSWEKYLEET 458

  Fly  1045 GGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLED 1109
            |..||....|..|.|..:|..:|||.||:|||.|||.||:...:.:|:::|.|.|..||.:||:.
Zfish   459 GTQAAPARAFKQRPPHGFQVGVKLEAVDKRNPMLIRVATISDTEEHRIKIHFDGWSDEYDYWLDA 523

  Fly  1110 DSPDLHPIGWCEATSHELETPPGYLQPKSVMP---CDVEGCRGFGNAKRFNLNVHALRECCPYA- 1170
            |||:|||:|||:.|.|.|:.|.| .:...|.|   |...||.|.|:.:......|.....|||: 
Zfish   524 DSPELHPVGWCQKTGHPLQHPNG-TRDSPVPPGQGCPTPGCNGVGHIRGPRYGTHYTAVSCPYSD 587

  Fly  1171 ---------PENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAE 1226
                     |:.....|..|:..|   |.:.|.....:|.:..|.|......|:           
Zfish   588 LNFNKDGLVPDRLSGERPVTISGP---PRHRRAETLTQTHQPTSSASTPEPPDT----------- 638

  Fly  1227 VVQAKRKTSPCEEKVVK-------KQKQMQKEEDAEQVPDERSLAIARSFVKDYGPQFL------ 1278
            ...|..:..|..|.||.       |..|:::|.|.                ||...|||      
Zfish   639 TTDACPQARPVREHVVTAAAPKCVKAPQVKQEGDG----------------KDSLQQFLHESVFC 687

  Fly  1279 ----PNYRL-WQ-----LNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRA 1333
                |.::| |:     |..|..|...|.:  .|.:.:|..::.......:.|....::.|||.|
Zfish   688 GWEQPRFQLCWEKHGKLLPEALGLTAKRVS--KWNTEEVASFVRGLPGCREHAPTFRKEQIDGEA 750

  Fly  1334 LLMLGRKELDTYLKLKVGPAVKLYSLILNLRIA 1366
            .|:|.:.::...|.:|:|||:|:|:.||.|:.|
Zfish   751 FLLLTQSDIVKILSIKLGPALKIYNSILMLKSA 783

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 51/98 (52%)
MBT 929..1028 CDD:214723 39/100 (39%)
MBT 1038..1130 CDD:214723 42/92 (46%)
SAM_PNT 1279..1366 CDD:280377 26/93 (28%)
l3mbtl1bXP_009290632.1 MBT 238..333 CDD:214723 50/96 (52%)
MBT 346..440 CDD:214723 38/97 (39%)
MBT 452..544 CDD:214723 42/92 (46%)
zf-C2HC 557..584 CDD:279824 7/27 (26%)
SAM_Scm-like-3MBT3,4 716..781 CDD:188981 19/67 (28%)
SAM 716..781 CDD:197735 19/67 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86177093
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H18226
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 1 1.000 T597284
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 LDO PTHR12247
Phylome 1 0.910 0.771 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.