DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and scml2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_009304396.1 Gene:scml2 ZFINID:ZDB-GENE-130530-546 Length:723 Species:Danio rerio

Alignment Length:759 Identity:165/760 (22%)
Similarity:264/760 (35%) Gaps:229/760 (30%)


  Fly   791 QTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNC------ 849
            |.:.|.||..|....: ..:...|..:.|.|..||:.            .:..|.||:|      
Zfish     6 QKDKKHHKEKSGRNNE-DSQPSQKLTEAFSWEMYLRE------------TSSCPASPSCFRQSRV 57

  Fly   850 -----FEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCD 909
                 |.:|||:||.||.|.|.:|:.:::.:.|.||:|..||..|..|||...|:.||.|.|.|:
Zfish    58 PPANDFRVGMKVEACDPRNASSWCIATVMGLMGVRLRLRLDGSDSTNDFWRLVDAADIQPIGTCE 122

  Fly   910 ETARVLQAPKDYNSERFSWSRYLVKT--GGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLN 972
            ::..:||.|..:.....||..:|:||  |.:.||.:.|   ..:.....:|.|..||.|||.|..
Zfish   123 KSGDMLQPPLGFRMNASSWPMFLLKTLSGAEMAPSSAF---KKEPPRPTQNFFKAGMKLEAVDRK 184

  Fly   973 DTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLIVP---------- 1027
            :...||.||:.::..::|.:.||||...:|.|....|..|.|.||.:.....:.|          
Zfish   185 NPYLICPATIGEVRGDKIFIMFDGWRGAFDYWCQFDSRDIFPVGWCQLTNHSLQPPGNCFTIPKT 249

  Fly  1028 --PDYQKSAFIWDDYIS-------------------------EVGGMAASKE------------- 1052
              |...:.:..|....|                         .:..:.|:.|             
Zfish   250 LLPSVSRPSPSWRPMQSPYRLPHPLPPLPVRKGVRGRRPKSQTIAMLKAAAEAAAAGNSPSQNGQ 314

  Fly  1053 ----------LFTPRQPMEYQER--------------------MKLEVVDQR------------- 1074
                      :.:|..|..|::|                    :...|.|.|             
Zfish   315 SQPTSAHKSPISSPLTPKPYKKRGPKPGSKRKPKVPHSLSSPILSSSVSDGRLSSLQTTRDSGVV 379

  Fly  1075 -------------NPCLIR-----------PATVVTRKGYRVQLHLDC--WPTEYYFWLEDDSP- 1112
                         .|.|.|           |..|.|...:.||..:||  .|...:.:|:..|. 
Zfish   380 STVCVYVNKHGNSGPHLDRKLLLQLPDHFGPGPVNTVLQHAVQACVDCAFQPKALFSFLQSQSDG 444

  Fly  1113 ----------DLHPIGWCEATSHE-----LETPPGYLQPKSVMPCDVEGCRGFGNAKRFN---LN 1159
                      .:|.:....|:|..     |||...:||           |....:::.|:   .:
Zfish   445 GEIIRVRSEGGIHYVKLPTASSASFVLRFLETLCHHLQ-----------CDNLFSSQPFSPLTSS 498

  Fly  1160 VHALRECCPYAPENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKV 1224
            .|.     ||.       |||:||.......::.|| .::..|..|....|:....|:....|..
Zfish   499 THT-----PYE-------RSKSVKEETSEALSVARG-TRRFNRDSSAYSTALSPKLQRTEALPSD 550

  Fly  1225 AEVVQAKRKTSPCEEKVVKKQKQMQKEEDAEQVPDERSLAIARSFVKDYG-----PQFLPNYRLW 1284
            ..:..|:...| .|::.:::......:..|.:.|..||.:   .|....|     |...|..|..
Zfish   551 ETIAHAENGAS-TEQQFLEESMDSASKSVAPRPPAHRSTS---EFHTPTGSSPHYPSHPPLLRGL 611

  Fly  1285 QLN------------------------SAFKLDDVRTNPLHWTSWDVCEYIERALDST-----DI 1320
            ..|                        .|.:.|..:|:....:||.:.|.::...|:.     ..
Zfish   612 SSNPAEPRTHRRVEGRLSASSTTGPDHQATEKDPSKTSNKSPSSWSIEEVMQFVRDADPQALGPH 676

  Fly  1321 AKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364
            |::..:.:|||:||::|....:..|:.||:|||:||...|..|:
Zfish   677 AELFRKHEIDGKALMLLRSDMIMKYMGLKLGPALKLCHHIEKLK 720

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 35/107 (33%)
MBT 929..1028 CDD:214723 32/113 (28%)
MBT 1038..1130 CDD:214723 29/215 (13%)
SAM_PNT 1279..1366 CDD:280377 27/116 (23%)
scml2XP_009304396.1 MBT 36..131 CDD:214723 35/107 (33%)
MBT 142..240 CDD:214723 32/101 (32%)
DUF3588 381..490 CDD:288954 22/120 (18%)
SAM_Scm 650..721 CDD:188977 21/72 (29%)
SAM 653..722 CDD:197735 21/69 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87420855
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.