DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_009296927.1 Gene:phc3 ZFINID:ZDB-GENE-070912-369 Length:890 Species:Danio rerio

Alignment Length:882 Identity:173/883 (20%)
Similarity:295/883 (33%) Gaps:294/883 (33%)


  Fly    58 PRKEELRFLPLAPMGGNKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVP 122
            |.:|||:     ..||..|.:.|:::..|..:.:...||               |:|....|::.
Zfish     7 PSQEELK-----GDGGVTTASTTVTSTTPTGTSIPLGNI---------------SSDRQAVQVIQ 51

  Fly   123 SPSNPSQPLVA-----ILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLT----VETSNKPIQP 178
            ...:..|.:.|     :.|..::..||...|...|        ..|:.:||    :.|::...|.
Zfish    52 QTLHRPQSMTAQYLQQMYAAQQQHILLQTAALQQQ--------QQHQQNLTAAQILTTTDTAAQT 108

  Fly   179 GGSAAAAAVGGGTGGAP-LTLVGKTVVP----PKIQAATPVQI---PSTGPGA---QVSLLANP- 231
            .||...::.....|..| |..|.:|.:|    |..|....:|:   .||| ||   |..||.|. 
Zfish   109 NGSQFISSPSSSHGNGPQLANVTQTSIPIPTSPVTQPMARIQVTSSSSTG-GAISQQAMLLGNSS 172

  Fly   232 ----------------LKPRAPLI-----LSKVAVDKLRLKFSQVKS------NPNALVLGKANH 269
                            |.|.|.:.     |:.|:....:...|||:|      .|.||...:...
Zfish   173 PTGSQAQMYLRTQMLILTPAATVAAVQPDLTVVSSISSQSASSQVQSLALRTHLPGALTTSQNIQ 237

  Fly   270 VK-----KLLTSPNPSGE--------------DKTRSTQ-KNNKQNTSASQLKPVVAPKTAMPIA 314
            :|     :.|.||.|...              :.:||.. .||...|.::|  |.:.|.|..|:.
Zfish   238 IKPPLQGQTLVSPPPKMSICPLKSTQLPQNLVETSRSVSVLNNVTQTPSAQ--PAIPPSTFTPVQ 300

  Fly   315 TEV-----------PTADNNKMSLIKSK-------PVAIKAVPLPSQEAPI------VPAVAPVV 355
            :..           |......:.:.:|.       |:.::.........|.      .|..|.|.
Zfish   301 SHQLIRHQLHCPSGPRVAPQHLIIQQSSSTHRQLHPITLRVTAQDGSPTPFTLHTRTTPTTATVQ 365

  Fly   356 TSPEKV-----DVKPTAKPSIKTAPK---PTPKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVK 412
            :...::     ....||..:..|:|.   |.|.||.:   |||.|                    
Zfish   366 SQQTELLSVPSSTNQTANQTKYTSPPAVLPDPPPLHL---GPALE-------------------- 407

  Fly   413 EIAQHTPCG-PKELPKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPS----AAIETI 472
            .::|:||.. |   |.||                                :.||.    .:::.:
Zfish   408 PVSQYTPLSCP---PPLK--------------------------------LVQPQRLALRSVQAV 437

  Fly   473 TIEDDDE--SEEEQQKPE-IKKTPKQNQKPEKQEAPKKKQIPMPILPAGITISTTSTAKKKAVRK 534
            .::.|..  ||||....| :.:.|.|:..|     |:...:.:.:.||    :.|..::...:.:
Zfish   438 EVQSDHTLLSEEELPLTEAVLQLPFQSLPP-----PQTVAVDLKVQPA----TQTEASQVTPLLE 493

  Fly   535 NSSVTTIS------------SSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSREDF 587
            :.::|.::            :|||.:.|.||   .|.:.::          ::         .|.
Zfish   494 SENLTLVTDAEHASPPQNSRTSSSPTLSQSD---EPQRSSD----------VV---------TDQ 536

  Fly   588 ERSLRCDEQVPQTPPKSS--SSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSS 650
            ..:|..|::.|..|...|  .|....:||:. ||.|.|:....||....:|......:..||.:.
Zfish   537 PENLTADQEQPCVPSSRSVIRSPEEPTHATS-SPSPLLSSAVRSSSRLSSASLPESPEGRPSQAI 600

  Fly   651 KTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRP 715
            ........:::...:.:  |.:|..:::  |..|:|    ||.........|.:|..:.   |.|
Zfish   601 SRPHILTHLIEGFVIRE--GLEPFPVRH--VSLEMN----LQATLPENREDGESALIDA---DHP 654

  Fly   716 GRRPSACVH-------------PLLYLCQRCNFHGPAADFL-APHFCSVGCVRRSQ---KRRLPQ 763
            .....:.:.             |.:..|:.|...|.|..|| :..|||:.|.||..   |:||  
Zfish   655 DSSSDSDIDDPPAEDEQTVEKLPEVLECEFCGKRGLAQAFLRSKRFCSMTCARRFNLRCKKRL-- 717

  Fly   764 STQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSL 800
            :..:|.|::                     |.||:|:
Zfish   718 NRLREEKVT---------------------YWPHRSM 733

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
phc3XP_009296927.1 SAM_Ph1,2,3 821..889 CDD:188976
SAM 823..890 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5017
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.