DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and si:ch211-230g15.5

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_017209418.1 Gene:si:ch211-230g15.5 ZFINID:ZDB-GENE-091204-280 Length:960 Species:Danio rerio

Alignment Length:880 Identity:179/881 (20%)
Similarity:292/881 (33%) Gaps:317/881 (36%)


  Fly     4 LSMASAEAKQLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLT-LAPRKEELRFLP 67
            :|.||: ::|..:.|||..:|.:..::....:....|...|     |.:||. .:|...:.:.|.
Zfish    95 VSQASS-SQQTPKTISLPNTPGSTALVRGGQSAVTAVRKIS-----PQTLLLGKSPSTSQAQMLL 153

  Fly    68 LAPMGGNKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSPSNPSQPLV 132
            .|.|      .|..|.|:|      .|..:.:|..|:.:.::..|:.:.    .||.|:|..|..
Zfish   154 RAQM------LILTSAVRP------DVPALSSSFSSSSSFSSSSSSSSS----TPSSSSPRFPST 202

  Fly   133 AILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTV--------ETSNKP------------IQ 177
            .:                 |.:.||...|   .:||:        .||::|            ::
Zfish   203 QL-----------------QSLTIRPPPP---GTLTIPPNLPLKPTTSSQPPPLSCPRIPTFHLR 247

  Fly   178 PGGSAAAAAVGGGT-GGAPLTLVGK--------TVVPPKIQAATPVQIPSTG-----------PG 222
            |...|.|....|.| ..:|.:...:        ||.||.:.|  |.|..:..           |.
Zfish   248 PSQPANAPGKDGATKSESPTSQTAQTKTPVRHLTVPPPSLYA--PAQAHALAKQKLNSSSLKRPH 310

  Fly   223 AQVSLLANPLKPRAPLILSKVAVDKLRLKFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTRS 287
            :|:|:..:|                    |:|..:.||:........:.:|...|:      |::
Zfish   311 SQISIPQHP--------------------FNQRHTPPNSPPATPKKPLPELKRCPS------TQA 349

  Fly   288 TQKNNKQNTSASQLKP------VVAPKTAMPIATEVP----------------------TADNNK 324
            :|..:.|:.|.|...|      :..|...:|:.:..|                      |...:|
Zfish   350 SQSISPQSASVSITVPSPARAHLTPPTLTLPLRSSSPGGSLLATKQLLRIALSSASAQCTNGQSK 414

  Fly   325 MS-------LIKSKPVAIKAVPLPSQEAPIVPAVAPVVTSPEKVDVKPT-----AKPSIKTAPKP 377
            .:       ||:|||:....:..|  |.|..|.:.| .|.|:.|.:.|:     |.|.|.|.|..
Zfish   415 TATVSPPHDLIQSKPLLSPVLAKP--ECPTQPLLTP-NTCPQLVQLSPSRQTTAATPLITTPPLA 476

  Fly   378 TPKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPVVKEIAQHTPCGPKELPKLKRSKSFVSNHPASP 442
            :|                      |:.....||:..::..:...|                |.||
Zfish   477 SP----------------------QRASPPSPVLPLVSTSSILAP----------------PQSP 503

  Fly   443 VANNERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQEAPKK 507
            :.:                 :.|:...||:. |..|..||::|....::||:..:.|    ||:|
Zfish   504 LTS-----------------QSPTQITETLK-EPKDRKEEQKQGTVPEQTPQDLKCP----APQK 546

  Fly   508 K------QIPMPILPAGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKEL 566
            |      |:|             |.|.:|.:  |..:....:|.:|..         .|.::|..
Zfish   547 KMTQAVDQLP-------------SEASEKVL--NKIIVCTENSRTDGQ---------IKTSQKNE 587

  Fly   567 SMLPGISIIKAESLPLSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSP-PPKLADPKPSS 630
            :..|.::...||.              |:|..:|..:|.:.|:..|.:|:||| ...:|.|...|
Zfish   588 THSPSVAPWPAEK--------------DDQCEETSTQSDNHSAISSLSSDMSPIQSSIAQPLDMS 638

  Fly   631 P-----PAKNAKKANDHDANPSP---SSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNE 687
            |     |.|      .|.....|   ||..:..|.:          .|||.:......|...|.|
Zfish   639 PVDSCFPPK------FHPVLERPLVQSSTLSQMKDT----------EGQQASGAPKPLVLTHLVE 687

  Fly   688 FNFLQINERCQP-RQGPAAYFERPLYD-------RPGRRPSACVHP------------------- 725
             .|: |.|..:| ....::....|:.|       .||..||...||                   
Zfish   688 -GFI-IQEGLEPFPVSRSSLMVGPVQDSGVNGVKEPGLIPSGSEHPEDSTDSDDEDGVANSNGVG 750

  Fly   726 ----LLYLCQRCNFHGPAADF-LAPHFCSVGCVRR 755
                |:..||.|...|.|..| .:..|||..|.:|
Zfish   751 RAHKLVLQCQFCKRKGTAQTFPRSKRFCSKSCAKR 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
si:ch211-230g15.5XP_017209418.1 SAM_Ph1,2,3 889..957 CDD:188976
SAM 891..957 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5017
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.