DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and sfmbt2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005164891.1 Gene:sfmbt2 ZFINID:ZDB-GENE-041210-196 Length:861 Species:Danio rerio

Alignment Length:865 Identity:174/866 (20%)
Similarity:277/866 (32%) Gaps:327/866 (38%)


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPIS-PNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKL 882
            |.|.|||:..|. .||| |.......:| .:.|:.|||||..:..:...:.|.:|:...|..|.|
Zfish    10 FNWEEYLEDTGA-TAAP-HTSFRHVELSLQSSFQPGMKLEVANKGSVDTYWVATIITTCGQLLLL 72

  Fly   883 SFDGYSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYN-------SERFS-WSRYLVK--T 935
            .:.||..  ..|||.:..:.::.|.|||.:..:.||.|:| |       .|::| |:.:|:|  |
Zfish    73 RYCGYGEDRKADFWCDVMTAELHPVGWCAQNDKTLQPPED-NVYLRAAIKEKYSDWTEFLIKELT 136

  Fly   936 GGKAAPRALF-GHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDD 999
            |.:.||..|. |.|..:..:|:   ...|..||..|.::........|...:..|:.:.:.|.:|
Zfish   137 GSRTAPANLLEGPLRGKNTVDL---IMEGSILELRDASEPSVYWATQVQRNVGGRLCLSYVGLND 198

  Fly  1000 -CYDLWVHITSPYIHPCGWHEGRQQLIVPP----DYQKSAFIWDDYISEVGGMAASKELFTPRQP 1059
             .|.:|:......:.|.||.:.....:.||    |.:.|: .|...:.|....|.:..|     |
Zfish   199 PSYYMWMFYLDTRLRPLGWAKENNLPMKPPTDLCDLRSSS-EWTTALDEATAEALNNPL-----P 257

  Fly  1060 ME------------YQERMKLEVVDQRNPCLIRPATVV-TRKGYRVQLHLD-------------- 1097
            :|            ::..||||:|....|..|.|.:|. ....|..|:.:|              
Zfish   258 LEVFKDHADLHTHSFRAGMKLEMVSPVEPFHICPVSVTKVYNEYHFQITVDDLTADATPTSAVCH 322

  Fly  1098 -----------------------------------------------CWPTEYY-------FWLE 1108
                                                           |:|....       .|||
Zfish   323 AESPGILPVQWCLKNGVELERPRGFETQDFDWADYLKHTSTEAAPDACFPNASQSRGFCKDMWLE 387

  Fly  1109 DDSP----------------------------------------DLHPIGWCEAT----SHELET 1129
            ..:|                                        ::.|:|||||.    :|.|:|
Zfish   388 AVNPLHPAELCVARITQVKGCLLWLRLEGLTKPLPDCIVDVESMNIFPVGWCEANGYPLTHSLKT 452

  Fly  1130 ------------PPGYLQPK----------SVMPCD---VEG---C-RGFGNAKRFN---LNVHA 1162
                        |...|.|.          |..|.|   |.|   | :.|.|.:.|:   ||...
Zfish   453 VCLPQKKIAVVQPEKQLAPSQSPDIPISLCSSAPMDSGLVNGKYCCSQLFINHRCFSGPYLNKGR 517

  Fly  1163 LRE---------CCPYAPENWRQWRSKTVKPPRV--------------APENIRRGWAKKT---- 1200
            :.|         |.....|......:...||.||              ..|.::..:..|:    
Zfish   518 IAELPKAVGPGKCAVVLKEILTMLINSAYKPGRVLRELQMVEDPQWNCQEETLKAKYKGKSYRST 582

  Fly  1201 --------------KRAC------------------------SEAKQAIKEDSQQEIVYPKVAEV 1227
                          :|.|                        |:.|.......::::..|.:.|.
Zfish   583 MRIVRTADQVSEFCRRVCERLQCCLNLFGPTFVSDKCPENCSSQTKTKYTYYKKRKVGRPSLGEN 647

  Fly  1228 VQAKRKTSPCEEKVVKKQKQMQK--------------------------EEDAEQVPDERSLAIA 1266
            .|....:.|...:..:|...:||                          :||.|:...|.|.:..
Zfish   648 AQDGDLSKPARRRKKRKAIFVQKKRRSSIVGYHTTESPQDSDYNYDEDEDEDFEEWGSEASSSSL 712

  Fly  1267 RSFVKDYGPQFLP-----------------------------------NYRLWQL--NSAFKLDD 1294
            |.....:..  ||                                   :|...|:  ::..|::.
Zfish   713 REEASAHNS--LPRRGRPPRRAALQRRMTHPGSETSDRISPRRTTRSVSYSQNQMARDTNVKMES 775

  Fly  1295 VR--------TNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVG 1351
            ..        ||||.|:..||.::| .:.|...:||:..||||||:|||:|....:...:.||:|
Zfish   776 TEEEDRLVLDTNPLQWSVSDVVDFI-TSTDCASLAKIFQEQDIDGQALLLLTLPTVQECMDLKLG 839

  Fly  1352 PAVKLYSLILNLRIAVVCKF 1371
            ||:||...|..:::|...::
Zfish   840 PAIKLCHQIERVKVAFYSQY 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 31/99 (31%)
MBT 929..1028 CDD:214723 24/103 (23%)
MBT 1038..1130 CDD:214723 32/229 (14%)
SAM_PNT 1279..1366 CDD:280377 33/132 (25%)
sfmbt2XP_005164891.1 MBT 13..110 CDD:214723 31/99 (31%)
MBT 134..228 CDD:302657 22/97 (23%)
MBT 277..348 CDD:280910 11/71 (15%)
MBT 356..447 CDD:214723 12/91 (13%)
DUF3588 498..612 CDD:288954 17/114 (15%)
SAM_Scm-like-4MBT1,2 777..861 CDD:188980 30/85 (35%)
SAM 788..852 CDD:197735 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86649219
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.