DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and MBTD1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_011523224.1 Gene:MBTD1 HGNCID:19866 Length:717 Species:Homo sapiens

Alignment Length:845 Identity:187/846 (22%)
Similarity:274/846 (32%) Gaps:327/846 (39%)


  Fly   593 CDEQVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKK 657
            |.|.       :||||||.....|::|.|                                    
Human    31 CSED-------TSSSSSSEESEEEVAPLP------------------------------------ 52

  Fly   658 SMMQNLNMLKWRGQQPANLQNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSAC 722
               .||.::|..||                                       :|..|..:..  
Human    53 ---SNLPIIKNNGQ---------------------------------------VYTYPDGKSG-- 73

  Fly   723 VHPLLYLCQRCNFHGPAADFLA--PHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPD 785
                :..|:.|...|....|.:  ..||||.|     .|....:::|.|.::|.|:         
Human    74 ----MATCEMCGMVGVRDAFYSKTKRFCSVSC-----SRSYSSNSKKASILARLQV--------- 120

  Fly   786 LPQKRQTNYKPHKSLSAIQEQ---------------LQQRQKDK---PRKPFRWSEYLKSKGKDV 832
                  |...|.|....:|:|               ||.:.|.|   ..:.|.|..|:.| ...:
Human   121 ------TGKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAAVSMEGFSWGNYINS-NSFI 178

  Fly   833 AAPIHLFLNPFPISPNCFEIGMKLEAIDPE-NCSL----FCVCSIVEVRGYRLKLSFDGY--SSM 890
            |||:..|.:. |:.....:|...:....|. :|||    |.:..||::.||...|.::|:  .|.
Human   179 AAPVTCFKHA-PMGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLAGYNALLRYEGFENDSG 242

  Fly   891 YDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAP------------ 941
            .|||.|....||.|.|||..:.:.|..|:....:..:|..:|||  ||.|..|            
Human   243 LDFWCNICGSDIHPVGWCAASGKPLVPPRTIQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQ 307

  Fly   942 ----------------------------------------------------RALFGHLNMQQQM 954
                                                                ..|..|:...:.:
Human   308 YPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSI 372

  Fly   955 DVR-------------------------------NGFAVGMHLEAEDLNDTGKICVATVTDIL-D 987
            ..|                               ..|..||.|||.|..:...|||||:..:| |
Human   373 GHRFKRSDITKKQDGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLAD 437

  Fly   988 ERIRVHFDG--------WDDCYDLWVHITSPYIHPCGWHEGRQQLIVPP-DYQKSAFIWDDYISE 1043
            ..:.:..||        | .||    |.|||.|.|.|:.|.....:.|| .|.|..|.|.||:.|
Human   438 GFLMIGIDGSEAADGSDW-FCY----HATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRE 497

  Fly  1044 VGGMAASKELFTPRQPME-YQERMKLEVVDQRNPCLIRPATVVTRKGYR-VQLHLDCWPTEYYFW 1106
            .|.:||..:||....|.. ::..||||.||...|.||..|| |||..:| :::|.|.|..||..|
Human   498 TGSIAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLICVAT-VTRIIHRLLRIHFDGWEEEYDQW 561

  Fly  1107 LEDDSPDLHPIGWCEATSHELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAP 1171
            ::.:||||:|:|||:.|.::|:.|                                       |.
Human   562 VDCESPDLYPVGWCQLTGYQLQPP---------------------------------------AS 587

  Fly  1172 ENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAI----------KEDSQQEIVYPKVAE 1226
            ::.|:.:|.:.|..:.|.....:|..||.|....:...::          :..|..|.:.|....
Human   588 QSSRENQSASSKQKKKAKSQQYKGHKKKRKMPIGKKPVSLSSLPMTGGVRRSFSGDEELTPPPYR 652

  Fly  1227 VVQAK------------RKTSPCEEKVVKKQKQMQKEE--DAEQ------VPDERSLAIARSFVK 1271
            .:.|:            |:.||..:.|...|   .|||  |.|.      ..|:.|...|..::|
Human   653 TLPAQTAPEAFPPPSTSREFSPSLKTVTTLQ---LKEELLDGEDYNFLQGASDQESNGSANFYIK 714

  Fly  1272  1271
            Human   715  714

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 31/103 (30%)
MBT 929..1028 CDD:214723 38/205 (19%)
MBT 1038..1130 CDD:214723 40/94 (43%)
SAM_PNT 1279..1366 CDD:280377
MBTD1XP_011523224.1 MBT 170..270 CDD:214723 31/102 (30%)
MBT 287..377 CDD:214723 7/90 (8%)
MBT 384..481 CDD:214723 28/102 (27%)
MBT 493..585 CDD:214723 40/93 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.