DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Sfmbt1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001160003.1 Gene:Sfmbt1 MGIID:1859609 Length:863 Species:Mus musculus

Alignment Length:867 Identity:180/868 (21%)
Similarity:295/868 (34%) Gaps:339/868 (39%)


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAI---DPENCSLFCVCSIVEVRGYRL 880
            |.|.:||:..| ....|...|.:......|.|..|||||..   |||.   :.|.:|:......|
Mouse    20 FSWEDYLEETG-STTVPYASFKHVDIRLQNGFAPGMKLEVALKNDPET---YWVATIITACEQLL 80

  Fly   881 KLSFDGYSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKT--GGKAAP 941
            .|.::||..  ..|||.:.....::|.|||.:..:.|:||:....:...|:.:|.:|  |....|
Mouse    81 LLRYEGYGEDRKADFWCDIRKAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPP 145

  Fly   942 RALF-GHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWD--DCYDL 1003
            .:|. |..|.:..:|:   .|.|..||.:|..|:....:.||.:.:..|:::.::|.:  |.::.
Mouse   146 VSLLEGLRNGRNPLDL---IAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESRDGFEH 207

  Fly  1004 WVHITSPYIHPCGWHEGRQQLIVPP---DYQKSAFIWDDYISEVGGMAASKE-------LFTPRQ 1058
            |::...|::|..||...:...:.||   .:.||...|.:.:::|      ||       ||..:|
Mouse   208 WLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKV------KEEEPLPSYLFKDKQ 266

  Fly  1059 PM---EYQERMKLEVVDQRNPCLIRPATVV--------------------TRKG----------Y 1090
            .:   |:...||||.||..:|..|.|||:.                    ||:.          :
Mouse   267 VIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRSFVCHANSPGIF 331

  Fly  1091 RVQ------LHLD---------------------------CWP---TEY---------------- 1103
            .||      ||::                           |:|   :|:                
Mouse   332 PVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQSISEHQFKENMKLEAVNPLFP 396

  Fly  1104 --------------YFWLE--------------DDSPDLHPIGWCEATSHELETPP--------- 1131
                          |.||:              .:|.::.|:||||...|.|.||.         
Mouse   397 EEVCIATVTAVRGSYLWLQLEGSKKPVPEFIVSAESMNIFPLGWCETNGHPLSTPRRARGHKLRK 461

  Fly  1132 -GYLQPKSVMPCDVEGCRGFGNAKRFNLN-VHAL----RECCPYAPENWRQWRSKTVKPPRVA-- 1188
             ..:||:.    .:...|......:..|| .|::    :.|||....|.|.:....:...|:|  
Mouse   462 IAVVQPEK----QILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAEL 522

  Fly  1189 PENIRRG---------------WAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAK------- 1231
            |:.:..|               .|.|..|...|.:  :.:||    |:....||::||       
Mouse   523 PQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQ--LDKDS----VWHGCGEVLKAKYKGKSYR 581

  Fly  1232 ----------RKTSPCEEKVVK------------------------------------------- 1243
                      |.|..|.:..:|                                           
Mouse   582 ATVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGR 646

  Fly  1244 ----------------KQKQMQK-----------------------------EEDAEQVPDERSL 1263
                            |:::.:|                             ||||:. .||.||
Mouse   647 PPGGHSNLSCALKKSSKRRKRRKNIFVHKKKRSSASVDNTPVGSPQGSGGEDEEDADD-GDEDSL 710

  Fly  1264 ----------------------AIARSFVKDYGPQFLP-----NYRLWQLNSA------------ 1289
                                  :.:.|..:...|..||     |.|..|.:|.            
Mouse   711 TEGSTSEQQEELQEESEVSEKKSSSSSPTQSETPTPLPPDTQTNKRDAQTSSVSDDENKPPSPKE 775

  Fly  1290 --FKLDD---VRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLK 1349
              .::|:   :.:|||.|:..||..:| |:.|...:|::..:|:|||:|||:|....:...:.||
Mouse   776 IRIEVDERLHLDSNPLKWSVADVVRFI-RSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLK 839

  Fly  1350 VGPAVKLYSLILNLRIAVVCKF 1371
            :|||:||...|..::.|...:|
Mouse   840 LGPAIKLCHHIERIKFAFYEQF 861

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 30/101 (30%)
MBT 929..1028 CDD:214723 25/104 (24%)
MBT 1038..1130 CDD:214723 39/212 (18%)
SAM_PNT 1279..1366 CDD:280377 32/109 (29%)
Sfmbt1NP_001160003.1 MBT 1 20..120 32/104 (31%)
MBT 23..120 CDD:214723 30/101 (30%)
MBT 2 128..232 26/107 (24%)
MBT 132..232 CDD:214723 25/103 (24%)
MBT 3 242..346 25/110 (23%)
MBT 245..346 CDD:214723 24/107 (22%)
MBT 4 354..451 15/97 (15%)
MBT 358..451 CDD:214723 15/93 (16%)
DUF3588 499..614 CDD:288954 23/121 (19%)
SAM_Scm-like-4MBT1,2 779..863 CDD:188980 29/85 (34%)
SAM 790..854 CDD:197735 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87288201
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.