DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Phc2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001182059.1 Gene:Phc2 MGIID:1860454 Length:850 Species:Mus musculus

Alignment Length:699 Identity:160/700 (23%)
Similarity:268/700 (38%) Gaps:164/700 (23%)


  Fly     3 PLSMASAEAKQLQRNISLSMSPANGGVI----SPSTANCNGVASAS---GGNPNPNSLLTLAP-- 58
            |.|..|::|.....:::|:.|||...:|    |.::|..:|:|..:   |...:|....:.|.  
Mouse   126 PGSSVSSQAPAQSSSLNLAASPAAAQLINRAQSVNSAAASGLAQQAVLLGNTSSPALTASQAQMY 190

  Fly    59 -RKEELRFLPLAPMGGNKTCNITISNVQ-----------PMKSKLKSVNIVPNSIKSAGA-GATV 110
             |.:.|.|.|.|          |::.||           |..::::::.:......:|.| |...
Mouse   191 LRAQMLIFTPTA----------TVATVQPELCTGSPARPPTPAQVQNLTLRTQQTPAAAASGPPP 245

  Fly   111 GSADAPLFQLVPSPSNPSQPLVAILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNKP 175
            .....|...|.|:||: ||||.   ||.:..|:..|..:..:|    |||.....:|.....|..
Mouse   246 TQPVLPSLALKPTPSS-SQPLP---APPQGRTMAQGSPAGAKP----SGTDNAPETLKAGDGNCN 302

  Fly   176 IQ--PGGSAAAAAVGGGTGGAPLTLVGKTVVPPKIQAATPVQIPSTGPGAQVSLLANPLKPR-AP 237
            ::  ||...|..||      |...|:.......:.....| |.|:..|..|......|..|| ||
Mouse   303 MEGRPGPGRAVPAV------ATHPLIAPAYAHLQSHQLLP-QPPAKHPQPQFVAQQQPQPPRPAP 360

  Fly   238 LILSKVAVDKLRLKFSQVKSNP--NALVLG----------KANHVKK----------LLTSPNPS 280
            .:.|:..:..:....: ::|:|  :||.||          ...||.|          .|.:.:.:
Mouse   361 QVQSQPQLASVSPSLA-LQSSPEDHALPLGSVTQALPLQCSTTHVHKPGNSQQCHLPTLDTGSQN 424

  Fly   281 GEDKTRSTQKNNK-QNTSA--SQLKPV--VAPKTAMPIA-TEVPTADNNKMSLIKSKPVAIKAVP 339
            |..:..|.....: |:|||  .|::|.  |.|:...|.. .||..|:       ||.||| :..|
Mouse   425 GHPEGGSHPPQRRFQHTSAVILQVQPASPVTPQQCAPDDWKEVVPAE-------KSVPVA-RPGP 481

  Fly   340 LPSQEAPIVPAVAPVVTSPEKVDVKPTAKPSIKT------APKPTPKPLEMSVNGPAKEKKAPAK 398
            .|.|:| |:||:...:..|:..:::..  |:.:|      |......|...|.||.:....|...
Mouse   482 SPHQQA-IIPAIPGGLPGPKSPNIQQC--PAHETGQGIVHALTDLSSPGMTSGNGNSASSIAGTA 543

  Fly   399 EQKQKTMDKPP--VVK-EIAQHTPCGPKELPKLKRSKSFVSNHPASP---------VANNERRHS 451
            .|..:  :|||  :|| :|..|.            .:.||....|.|         |.|.:::::
Mouse   544 PQNGE--NKPPQAIVKPQILTHV------------IEGFVIQEGAEPFPVGRSSLLVGNLKKKYA 594

  Fly   452 VAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTP-----------------KQNQKP 499
            ...:.      |:|.....|.|.:.:.|....|:..| :.||                 |::::.
Mouse   595 QGFLP------EKPPQQDHTTTTDSEMEEPYLQESKE-EGTPLKLKCELCGRVDFAYKFKRSKRF 652

  Fly   500 EKQEAPKKKQIPMPILPAGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEK 564
            ......|:..:       |.|.........::..:.:..||.:...:..:|...:    ||.|:|
Mouse   653 CSMACAKRYNV-------GCTKRVGLFHSDRSKLQKAGTTTHNRRRASKASLPTL----TKDTKK 706

  Fly   565 ELSMLPGISIIKAESLPLSREDFERSLRCDE----QVPQTPPKSSSSSS 609
            :.|....:|:..|..|..|:||   |.||.:    :.|.:|..:|||:|
Mouse   707 QPSGTVPLSVTAALQLAHSQED---SSRCSDNSSYEEPLSPISASSSTS 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
Phc2NP_001182059.1 Intrinsically disordered. {ECO:0000269|PubMed:27827373} 1..79
Interaction with BMI1. {ECO:0000269|PubMed:27827373} 33..56
HD1 550..579 11/41 (27%)
PHC2_SAM_assoc 662..780 CDD:293222 25/106 (24%)
SAM_Ph1,2,3 781..849 CDD:188976
SAM 783..850 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87319278
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.