DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and SFMBT1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_057413.2 Gene:SFMBT1 HGNCID:20255 Length:866 Species:Homo sapiens

Alignment Length:891 Identity:168/892 (19%)
Similarity:271/892 (30%) Gaps:388/892 (43%)


  Fly   821 WSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEA---IDPENCSLFCVCSIVEVRGYRLKL 882
            |.:||:..| ..|.|...|.:......|.|..|||||.   .|||.   :.|.:::......|.|
Human    22 WEDYLEETG-STAVPYGSFKHVDTRLQNGFAPGMKLEVAVRTDPET---YWVATVITTCEQLLLL 82

  Fly   883 SFDGYSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKT--GGKAAPRA 943
            .:|||..  ..|||.:....|::|.|||::..:.|:||:....:...|..:|.:|  |..:.|..
Human    83 RYDGYGEDRRADFWCDIRKADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVP 147

  Fly   944 LF-GHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWD--DCYDLWV 1005
            |. |..|.:..:|:   .|.|..||.:...|:....:.||.:.:..|:::.::|.:  |.|:.|:
Human   148 LLEGLRNGRNPLDL---IAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWL 209

  Fly  1006 HITSPYIHPCGW------------------HEGRQQLIV-------------------------- 1026
            :...|::|..||                  :|...|.|:                          
Human   210 YYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHT 274

  Fly  1027 ----------------------------------------------------------------- 1026
                                                                             
Human   275 FSVNMKLEAVDPWSPFGISPATVVKVFDEKYFLVEMDDLRPENHARRSFVCHADSPGIFPVQWSL 339

  Fly  1027 --------PPDYQKSAFIWDDYISEVGGMAASKELFTPR-QPMEYQERMKLEVVDQRNPCLIRPA 1082
                    ||.|....|.|.||:.:.|..||.:..|.|. ...|::|.||||.|   ||.|....
Human   340 KNGLHISPPPGYPSQDFDWADYLKQCGAEAAPQRCFPPLISEHEFKENMKLEAV---NPILPEEV 401

  Fly  1083 TVVTRKGYRVQLHLDCWPTEYYFWLE--------------DDSPDLHPIGWCEATSHELETPP-- 1131
            .|.|....|..          |.||:              .:|.|:.|:||||...|.|.||.  
Human   402 CVATITAVRGS----------YLWLQLEGSKKPIPECIVSVESMDIFPLGWCETNGHPLSTPRRA 456

  Fly  1132 --------GYLQPKSVMP----------------------------------------------- 1141
                    ..:||:..:|                                               
Human   457 RVYKQRKIAVVQPEKQVPSSRTVHEGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGR 521

  Fly  1142 -CDVEGCRGFGN----------------------------------------------AKRFNLN 1159
             .::..|.|.||                                              .|.:...
Human   522 IAELPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKGKSYRAT 586

  Fly  1160 VHALR----------------ECCP--YAP--------EN------------WRQWRSKTVKPPR 1186
            |..::                ||||  :.|        ||            :.:.::|.:..|.
Human   587 VEIVKTADRVTEFCRQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPP 651

  Fly  1187 VAPENIRRGWAKKTKR--------------------------------------------ACSEA 1207
            ....|:.....|.:||                                            :.||.
Human   652 GGHSNLACALKKASKRRKRRKNVFVHKKKRSSASVDNTPAGSPQGSGGEDEDDPDEGDDDSLSEG 716

  Fly  1208 KQAIKEDSQQEIVYPKVAEVVQAKR-KTSPCEEKV---VKKQKQMQKEE--------DAEQVPDE 1260
            ..:.::|..||     .:|:.:.|. .:||.:.::   :...:|.:|.|        |..:.|..
Human   717 STSEQQDELQE-----ESEMSEKKSCSSSPTQSEISTSLPPDRQRRKRELRTFSFSDDENKPPSP 776

  Fly  1261 RSLAIARSFVKDYGPQFLPNYRLWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIF 1325
            :.:.|                   ::.....||   :|||.|:..||..:| |:.|...:|::..
Human   777 KEIRI-------------------EVAERLHLD---SNPLKWSVADVVRFI-RSTDCAPLARIFL 818

  Fly  1326 EQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCKF 1371
            :|:|||:|||:|....:...:.||:|||:||...|..::.|...:|
Human   819 DQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQF 864

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 32/101 (32%)
MBT 929..1028 CDD:214723 28/221 (13%)
MBT 1038..1130 CDD:214723 33/107 (31%)
SAM_PNT 1279..1366 CDD:280377 28/87 (32%)
SFMBT1NP_057413.2 MBT 1 20..120 33/102 (32%)
MBT 23..120 CDD:214723 32/101 (32%)
Antigenic epitope 34..42 2/8 (25%)
MBT 2 128..232 25/107 (23%)
MBT 131..232 CDD:214723 24/104 (23%)
MBT 3 242..348 2/106 (2%)
MBT 252..348 CDD:214723 0/96 (0%)
MBT 4 356..453 35/110 (32%)
MBT 360..453 CDD:214723 33/106 (31%)
DUF3588 502..617 CDD:288954 11/115 (10%)
SAM_Scm-like-4MBT1,2 782..866 CDD:188980 30/88 (34%)
SAM 793..857 CDD:197735 25/65 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87288617
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.