DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and ph-d

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_524794.2 Gene:ph-d FlyBaseID:FBgn0004860 Length:1537 Species:Drosophila melanogaster

Alignment Length:942 Identity:162/943 (17%)
Similarity:297/943 (31%) Gaps:320/943 (34%)


  Fly    13 QLQRNISLSMSPANGGVISPSTANCNGVASA-SGGNPNPNSLLTLAPRKEELRFLPLAPM----- 71
            |.|..:...:|.||||          |.||| :||..:|.:......::.......::||     
  Fly   182 QQQLQLQQQLSEANGG----------GAASAGAGGAASPANSQQSQQQQHSTAISTMSPMQLAAA 236

  Fly    72 ----GGNKTCNITISNVQPMKSKLKSVNIVPNSIKSAGAGATVGSADAPLFQLVPSPSNPSQPLV 132
                ||:.|...|:..:||..|.|     .|..|.|.                            
  Fly   237 TGGVGGDWTQGRTVQLMQPSTSFL-----YPQMIVSG---------------------------- 268

  Fly   133 AILAPNRKTTLLGGGASNGQPV-VIRSGTPLHKNS---LTVETSNKPIQPGGSAAAAAVGGGTGG 193
                     .||..|....||: ||.:|.|...|.   ||..|.|.....||.|..|  ||... 
  Fly   269 ---------NLLHPGGLGQQPIQVITAGKPFQGNGPQMLTTTTQNAKQMIGGQAGFA--GGNYA- 321

  Fly   194 APLTLVGKTVVP------PKIQAATPVQIPSTGPGAQVSLL------------------------ 228
                    |.:|      |:....:||.:.|..|..|.:||                        
  Fly   322 --------TCIPSNHNQSPQTVLISPVNVISHSPQQQQNLLQSMAAAAQQQQLTQQQQQQLNQQQ 378

  Fly   229 --ANPLKPRAPL--ILSKVAVD---KLRLKFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTR 286
              .|..:.:..|  .|:||.||   ||..|..|..:..::.|        :..|.|..:|..:|:
  Fly   379 QQLNQQQQQQQLTAALAKVGVDAQGKLAQKVVQKVTTTSSTV--------QAATGPGSTGSTQTQ 435

  Fly   287 STQKNNKQNTSASQLKPVVAPKTAMPIATEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAV 351
            ..|:..:|....:|                                                   
  Fly   436 QVQQVQQQQQQTTQ--------------------------------------------------- 449

  Fly   352 APVVTSPEKVDVKPTAKP------SIKTAPKPTPKPLEMSVNGPAKEKKAPAKEQKQKTMDKPPV 410
                |:.:.|.|..:..|      |::||        ::...|.|::.:.|...|....:.....
  Fly   450 ----TTQQCVQVSQSTLPVGVGGQSVQTA--------QLLNAGQAQQMQIPWFWQNAAGLQPFGS 502

  Fly   411 VKEIAQHTPCGPKELPKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPSAAIETITIE 475
            .:.|.::.|.|.:.:        |:...||:.....::...:     :.:|.:.|:.|...:...
  Fly   503 NQIILRNQPDGTQGM--------FIQQQPATQTLQTQQNQII-----QCNVTQTPTKARTQLDAL 554

  Fly   476 DDDESEEEQQKPEIKKTPKQN--------QKPEKQEAPKKKQIP-MPILPAGITISTTSTAKKKA 531
            ...:.:::||.....:|.:|.        |:.::|......|.| .|::|...|          .
  Fly   555 APKQQQQQQQVGTTNQTQQQQLAVATAQLQQQQQQLTAAALQRPGAPVMPHNGT----------Q 609

  Fly   532 VRKNSSVTTISSSSSDSSSYSDVEVVPTKKTEKELSMLPGISIIKAESLPLSRED-FERSLRCDE 595
            ||..|||:|.::.:.        .::..|...|:..:.|.::.:|.|...::.:: ....|...:
  Fly   610 VRPASSVSTQTAQNQ--------SLLKAKMRNKQQPVRPALATLKTEIGQVAGQNKVVGHLTTVQ 666

  Fly   596 QVPQTPPKSSSSSSSGSHASEMSPPPKLADPKPSSPPAKNAKKANDHDANPSPSSKTND----FK 656
            |..|........:::|:....||         .:..|.........|.|..:...|...    |:
  Fly   667 QQQQATNLQQVVNAAGNKMVVMS---------TTGTPITLQNGQTLHAATAAGVDKQQQQLQLFQ 722

  Fly   657 KSMMQNLNMLKWRGQQPANL----QNSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGR 717
            |..:....||:   ||.|.:    |.:.|:.:..:...:...::...:|..|...::....:..:
  Fly   723 KQHILQQQMLQ---QQIAAIQMQQQQAAVQAQQQQQQQVSQQQQVNAQQQQAVAQQQQAVAQAQQ 784

  Fly   718 RPSACVHPLLYLCQRCNFHGPAADFLAPHFCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGT 782
            :                                   :|.|::::.|:..:..:......:|....
  Fly   785 Q-----------------------------------QREQQQQVAQAQAQHQQALANATQQILQV 814

  Fly   783 APD---LPQKRQTNYKPHKSLSAIQEQLQQ--------------RQKDKPRKPFR---------- 820
            ||:   ...::|...:.|..|  ||:||||              :|:.:.|:..:          
  Fly   815 APNQFITSHQQQQQQQLHNQL--IQQQLQQQAQAQVQAQVQAQAQQQQQQREQQQNIIQQIVVQQ 877

  Fly   821 ----WSEYLKSKGKDVAAPIHLFLNPFPISPN 848
                .|:..:.:.:..:..:.|...||.:||:
  Fly   878 STGATSQQQQQQPQQQSGQLQLSSVPFSVSPS 909

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 6/28 (21%)
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
ph-dNP_524794.2 SAM_Ph1,2,3 1461..1529 CDD:188976
SAM 1464..1529 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85979600
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.