DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and mbtd1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001006742.1 Gene:mbtd1 XenbaseID:XB-GENE-949653 Length:651 Species:Xenopus tropicalis

Alignment Length:701 Identity:168/702 (24%)
Similarity:254/702 (36%) Gaps:249/702 (35%)


  Fly   560 KKTEKELSMLPGISIIKAESLPLSRED----FERSLRCDEQVPQTPPKSSSSSSSGSHASEMSPP 620
            :|| |:|:.|..:|..|       |.|    |:....|.|.       :||||||.....|::  
 Frog     2 EKT-KDLADLSSLSERK-------RRDSFGMFDGYDSCSED-------TSSSSSSDESEEEVA-- 49

  Fly   621 PKLADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFEL 685
                 |.|||.|                                ::|..||              
 Frog    50 -----PLPSSLP--------------------------------IIKNNGQ-------------- 63

  Fly   686 NEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFLA--PHFC 748
                                     :|..|..:..      :..|:.|...|....|.:  ..||
 Frog    64 -------------------------VYTYPDGKSG------MATCEMCGMVGVRDAFYSKTKRFC 97

  Fly   749 SVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKD 813
            ||.|     .|....:::|.|.::|.|      ..|...:.:....||..:..|...|.:...|:
 Frog    98 SVSC-----SRSYSSNSKKASILARLQ------GKPPTKKAKVLQKKPLVAKLAAYAQYKATLKN 151

  Fly   814 KP--RKP-----FRWSEYLKSKGKDVAAPIHLFLNPFPISPNCF-EI--GMKLEAIDPEN---CS 865
            :.  :.|     |.|..|:.| ....|||:..|.:. |:. ||: :|  |:::|..:.::   ..
 Frog   152 QSVNKAPVTVEGFSWGNYITS-NNTAAAPVTCFRHA-PMG-NCWGDIAEGVRVEVPNTDSNLPTK 213

  Fly   866 LFCVCSIVEVRGYRLKLSFDGY--SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSW 928
            :|.:..||::.|:...|.::|:  .|..|||.|....|:.|.|||..:.:.|..|:....:..:|
 Frog   214 VFWISGIVKLAGFNALLRYEGFENDSSLDFWCNICGPDVHPVGWCATSGKPLVPPQTIQHKYTNW 278

  Fly   929 SRYLVK--TGGKAAP---------------------------------------------RALF- 945
            ..:|||  ||.|..|                                             |.:: 
 Frog   279 KAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPSMRVEVVDKTHLCRTRVAVVDSVIGGRLRLVYE 343

  Fly   946 ---------------------------GH-------LNMQQQ------------MDVRNG---FA 961
                                       ||       |..|:.            .|:..|   |.
 Frog   344 ESEDKTDDFWCHMYSPLIHPIGWSRSIGHRFKRTDILKKQESNYDAPSHLFTKVKDIEQGSEWFK 408

  Fly   962 VGMHLEAEDLNDTGKICVATVTDIL-DERIRVHFDG--------WDDCYDLWVHITSPYIHPCGW 1017
            .||.|||.|..:...|||||:..:| |..:.:..||        | .||    |.:||.|.|.|:
 Frog   409 EGMKLEAIDPLNLSAICVATIRKVLADGYLMIGIDGSEAADGSDW-FCY----HASSPSIFPVGF 468

  Fly  1018 HE-GRQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPME-YQERMKLEVVDQRNPCLIR 1080
            .| .:.:|..|..|.|..|.|.||:.|.|.:||..:||....|.. ::..||||.||...|.|:.
 Frog   469 CEINKIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKEVPNHGFRVGMKLEAVDLMEPRLVC 533

  Fly  1081 PATVVTRKGYR-VQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETP 1130
            .|| |||..:| :::|.|.|..||..|::.:|.||:|:|||:.|.::|:.|
 Frog   534 VAT-VTRIIHRLLRIHFDGWEDEYDQWVDCESSDLYPVGWCQLTGYQLQPP 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 29/104 (28%)
MBT 929..1028 CDD:214723 42/206 (20%)
MBT 1038..1130 CDD:214723 38/94 (40%)
SAM_PNT 1279..1366 CDD:280377
mbtd1NP_001006742.1 MBT 1 164..268 31/107 (29%)
MBT 168..268 CDD:214723 29/103 (28%)
MBT 2 276..373 11/97 (11%)
MBT 285..375 CDD:214723 7/90 (8%)
MBT 3 374..479 31/110 (28%)
MBT 378..479 CDD:214723 31/106 (29%)
MBT 4 487..583 40/97 (41%)
MBT 491..583 CDD:214723 38/93 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.