DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and scmh1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001005790.1 Gene:scmh1 XenbaseID:XB-GENE-968911 Length:675 Species:Xenopus tropicalis

Alignment Length:683 Identity:163/684 (24%)
Similarity:248/684 (36%) Gaps:195/684 (29%)


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLS 883
            |.|.:|||..|...|.| |.|........|.::|||||||.||.|.:..|:.|:|.:.|.||:|.
 Frog    31 FSWEKYLKETGSQPAPP-HCFRQSCSPPSNDYKIGMKLEAQDPRNTTSTCIASVVGLTGARLRLR 94

  Fly   884 FDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKT--GGKAAPRALFG 946
            .||..:..|||...||.:|.|.|.|::...:||.|..:.....||..:|:||  |.:.||..:| 
 Frog    95 LDGSDNKNDFWRLVDSSEIQPIGTCEKGGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPAKIF- 158

  Fly   947 HLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPY 1011
              :.:.....:|.|.:||.|||.|..:...||.||:.::....|.|.||||...:|.|....|..
 Frog   159 --HKEPPSPPQNYFEIGMKLEAVDRKNPHFICPATIGEVRGSEILVTFDGWRGAFDYWCRYDSRD 221

  Fly  1012 IHPCGWHEGRQQLIVPPDYQ----KSAFIWDDYISEVGGMAAS-----KELF--TP----RQPME 1061
            |.|.||.......:.||..:    ||..       ...|:|.|     |.|.  .|    |:|..
 Frog   222 IFPVGWCSLTGDNLQPPGTKVAIPKSPL-------PAAGIATSMMRGPKNLLPVVPGRRRRKPGR 279

  Fly  1062 YQERMKLEVVDQ--RNPC-LIRPATVVTRKG------YRVQLHLDCWPTEYYFWLEDDSPDLHPI 1117
            .:.::...:|.|  ..|. |..|.....::|      .:.:|.|:..||.    ..:.:|:    
 Frog   280 KKGQLPKALVHQLSSQPSKLCEPFRFPKKRGPKPGSKRKPRLLLNQIPTS----PTNSTPE---- 336

  Fly  1118 GWCEATSHELETPPGYLQPKSVMPC------------DVEGCRG--------------FGNAKRF 1156
                   .:..|.|   |..:.:||            :..|..|              ||.|:..
 Frog   337 -------PDTSTVP---QDAATIPCAAMQAPTVCIYLNKNGESGPHLDRKKVQHLPDHFGPARAS 391

  Fly  1157 NLNVHALREC--CPYAPENWRQWRSKTVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEI 1219
            .:...|::.|  |.|        ..|||.      ..:::|..       .|...|:.|..|..:
 Frog   392 VVLQQAVQACIDCAY--------HQKTVF------SFLKQGHG-------GEVISAVFEREQHTL 435

  Fly  1220 VYPKVAEVVQAKR--------------------------KTSPCE-EKVVKKQKQMQ-------- 1249
            ..|.|..:....|                          :|..|| ::.:.::...:        
 Frog   436 NLPAVNSIGYVLRFLEKLCRNLRSENLFGNQPFTQNPSLQTGSCENDRYLAERSNCEGSLHGPGR 500

  Fly  1250 --KEEDAEQVPDERSL-----------AIARSFVKDYG-----PQFL------------------ 1278
              |...:|..|....|           :...:|:.|.|     .|.|                  
 Frog   501 GSKRYPSETPPYNAPLCPKLPKNDCHASEGETFMLDAGLPGSMEQHLGTADSPASPNTSRVSREY 565

  Fly  1279 --PNYRLWQLNSAFKLDDVR-----------------TNPLHWTSWDVCEYIERALDSTDI-AKV 1323
              |:||.....|:.....||                 .:|..|.:.||.:::..|...... |::
 Frog   566 RSPSYRSVHQPSSISQGTVRRLSSAESERYSSGRPAPRDPSLWNTEDVMQFVRDADPQLGFHAEL 630

  Fly  1324 IFEQDIDGRALLMLGRKELDTYLKLKVGPAVKL 1356
            ..:.:|||:|||:|....:..|:.||:|||:||
 Frog   631 FRKHEIDGKALLLLRSDVMMKYMGLKLGPALKL 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 39/96 (41%)
MBT 929..1028 CDD:214723 33/101 (33%)
MBT 1038..1130 CDD:214723 20/112 (18%)
SAM_PNT 1279..1366 CDD:280377 27/97 (28%)
scmh1NP_001005790.1 MBT 34..129 CDD:214723 39/96 (41%)
MBT 140..238 CDD:214723 33/101 (33%)
DUF3588 358..466 CDD:288954 20/129 (16%)
SAM_Scm 603..672 CDD:188977 21/62 (34%)
SAM 605..672 CDD:197735 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86872337
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.