DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Scm

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001247006.1 Gene:Scm FlyBaseID:FBgn0003334 Length:877 Species:Drosophila melanogaster

Alignment Length:946 Identity:209/947 (22%)
Similarity:325/947 (34%) Gaps:278/947 (29%)


  Fly   606 SSSSSGSHASEMSPPPKLADPKPSSPPAKNAK-KANDHDANPSPSSKTNDFKKSMMQNLNMLK-- 667
            ||:||||::         |.|..|:....:|. .|:....:.||.|.|:.......:.....:  
  Fly     7 SSTSSGSNS---------AAPGASTNATSSASASASSTSTSASPGSTTSPASTQRQRGRPAKRAT 62

  Fly   668 --WRGQQPANLQ----NSTVRFELNEFNFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPL 726
              |.|:....||    ..|.:.|.       .:|.|      .|.| |..|.:     .||..  
  Fly    63 CTWCGEGKLPLQYVLPTQTGKKEF-------CSETC------IAEF-RKAYSK-----GACTQ-- 106

  Fly   727 LYLCQRCNFHGPAADFLAPH--FCSVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQK 789
               |......|      ||:  |||:.|:.:.||:..  ||:           .:.|:|..    
  Fly   107 ---CDNVIRDG------APNKEFCSIMCMNKHQKKNC--STR-----------HSGGSASG---- 145

  Fly   790 RQTNYKPHKSLSAIQEQLQQRQKDKPRKPFR--------WSEYLKSKGKDVAAPIHLFLNPFPIS 846
                    |.|:..:.:|.......|..||:        |..||:..|.: |||...|.......
  Fly   146 --------KGLAESERKLLASGAPAPTGPFQYESFHVFDWDAYLEETGSE-AAPAKCFKQAQNPP 201

  Fly   847 PNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDET 911
            .|.|:|||||||:||.|.:..|:.::|.|.|.||:|..||..|..|||...||.:|...|.|::.
  Fly   202 NNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKN 266

  Fly   912 ARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDT 974
            ..:||.|..:.....||..||.|  .....||..:|   ..:......|.|.||..|||.|..:.
  Fly   267 GGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEIF---QPEPPEPEENLFKVGQKLEAVDKKNP 328

  Fly   975 GKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW------------HEGR------ 1021
            ..||.|||..|.|::|.|.||||...:|.|.:..|..|.|.||            |:.|      
  Fly   329 QLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPPGHKSRMDSSSS 393

  Fly  1022 QQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLE----VVDQRNPCLIRPA 1082
            :|....|.|.               :.|..|...|..|.........:    :.:.:.||::...
  Fly   394 KQRCPRPRYT---------------VVAESEAMVPASPATAHFHPNCKGGPFINNSKLPCMVTGP 443

  Fly  1083 TVVTRKGYRVQLHLDCWP-----TEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPKSV--- 1139
            |..|.....:|..|....     ::..|.||.|...:...|  :..:.::.:|......:|:   
  Fly   444 TYQTLAKLCLQEVLAASTDTQQLSKLLFALEGDVHIVTAAG--KNFTVKIPSPMRMKDDESLAQF 506

  Fly  1140 --------MPC--------DVEGCRGFGNAKRFNLNVHALRECCP-YAPENWRQWRSKTVKP-PR 1186
                    ..|        :.|.|:...|:::..|...|.....| .|.:..||..|.|..| .:
  Fly   507 IETLCTTCRACANLISLVHETEECKKCANSRKRQLTQSATPPSSPVLADKRNRQSNSATTSPSEK 571

  Fly  1187 VAPEN--IRRGWAKKTKRACSEAKQAIKED---------------SQQEIVY--------PKVAE 1226
            :..:.  ::.....|:|.:.:..|:...:.               |..::|.        .:.:.
  Fly   572 IIKQELAVKSPVESKSKTSTNNGKEPASQQNSNHSLNNNNNSASKSSNKVVIKSEPNGANAQTSS 636

  Fly  1227 VVQAKRK-----------------------------TSPCEEKVVKKQKQMQKEED--------- 1253
            ..||.||                             ||.|..........:.....         
  Fly   637 TTQALRKVRFQHHANTNTNSSATNGNQDTSQTTHVSTSHCSSSSTSSSTSLAGGSANTSTIGKYL 701

  Fly  1254 ----AEQVPDERSLAIARSFVKDYGPQFL------------------------------------ 1278
                ||..|::.::..:.|:.|  .|..|                                    
  Fly   702 APLVAEVHPEQANVKPSNSYYK--SPTTLSSSASLPTSVSTPFTGCQSASSTALAAGGVTAAKAA 764

  Fly  1279 -------------PNYR-----LWQLNSAFKLDDVRTNPLHWTSWDVCEYIERALDSTDIAKVIF 1325
                         |:|.     :....||.....:|:.|:.||..:|.:|||...:|..:...:|
  Fly   765 TAPAGAAATAGASPSYTAITSPVSTPTSALANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLF 829

  Fly  1326 -EQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLI 1360
             :.:|||:|||:|..:.:..|:.||:|||:|:.:|:
  Fly   830 RKHEIDGKALLLLNSEMMMKYMGLKLGPALKICNLV 865

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 39/96 (41%)
MBT 929..1028 CDD:214723 37/119 (31%)
MBT 1038..1130 CDD:214723 15/101 (15%)
SAM_PNT 1279..1366 CDD:280377 29/89 (33%)
ScmNP_001247006.1 zf-FCS 55..95 CDD:283998 9/53 (17%)
MBT 178..273 CDD:214723 39/96 (41%)
MBT <312..382 CDD:214723 28/70 (40%)
DUF3588 418..524 CDD:288954 14/108 (13%)
SAM_Scm 800..870 CDD:188977 25/67 (37%)
SAM 806..867 CDD:197735 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C85863264
eggNOG 1 0.900 E1_KOG3766
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.