DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and l3mbtl3

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001232893.1 Gene:l3mbtl3 ZFINID:ZDB-GENE-040724-127 Length:523 Species:Danio rerio

Alignment Length:498 Identity:189/499 (38%)
Similarity:269/499 (54%) Gaps:55/499 (11%)


  Fly   676 LQNSTVRFELNEFNFLQ-INERCQPRQGPAAY----FERPL------------YDRP-GRRPSAC 722
            |..|.::|.:|||..|: |.|..:..:|..|:    :..|.            .|.| |:|...|
Zfish    28 LPGSELKFRVNEFGVLEVITEEMEEERGKKAHATTTWSVPTAQEALSEGSVLKQDSPWGQRGLVC 92

  Fly   723 VHPLLYLCQRCNFHGPAADFLAPHF-CSVGCVRRSQKRRLPQSTQKESKI---SRTQLEQTA--- 780
            |        |||..|.|.|||.... ||..|:::.|:....:.::...::   .||:||::|   
Zfish    93 V--------RCNRKGSAVDFLPDGLHCSERCLQQEQEELKTEGSRMNGELLSRKRTRLERSAEDM 149

  Fly   781 GTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDK--------------PRKPFRWSEYLKSKGKD 831
            .::.|:|::...:|:..:|....:...:.|:|.:              .:|.:.|:.||:.: :.
Zfish   150 DSSMDIPEEEDEDYEEKESRRPARGATRGRKKRRGDAALLRYTVPYGGKKKAWCWASYLEQE-RA 213

  Fly   832 VAAPIHLF--LNPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFW 894
            :|||..||  ...||...|.|.:||:||.||||:.|::||.:|.||.|:|::|.||.:|..||||
Zfish   214 IAAPSKLFKEYQCFPQCKNGFRVGMRLEGIDPEHPSMYCVLTIAEVSGHRIRLHFDHFSDCYDFW 278

  Fly   895 VNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNG 959
            ||::|.||.|.|||::|...|..||....|.||||.|:.....:.||:|||.:.||..   ..:|
Zfish   279 VNSNSPDIHPVGWCEKTGHKLHPPKGMKDEEFSWSSYIKLNKIQTAPKALFHNQNMTV---TPSG 340

  Fly   960 FAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-HEGRQQ 1023
            |.|||.|||....|...||||||||::|.|..||||.|::.||.|...|||||||.|| .|..:.
Zfish   341 FRVGMKLEAVCRKDPTFICVATVTDMVDSRFLVHFDNWEESYDYWCDATSPYIHPVGWCQENGRT 405

  Fly  1024 LIVPPDY-QKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNPCLIRPATVVTR 1087
            |..||.| ..:.|.|:.|::|...:.|....|..:.|..:|..|||||||:|||.|||.|||...
Zfish   406 LSTPPGYPDANNFSWEKYLAETSSLPAPARAFKVKPPHGFQVNMKLEVVDKRNPVLIRVATVADT 470

  Fly  1088 KGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETP 1130
            ..:|:.:|.|.|..||.:|::.||||:||.|||..|.|.|:.|
Zfish   471 DDHRLWIHFDGWTDEYDYWIDADSPDVHPAGWCAKTGHPLQPP 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 46/98 (47%)
MBT 929..1028 CDD:214723 48/100 (48%)
MBT 1038..1130 CDD:214723 41/92 (45%)
SAM_PNT 1279..1366 CDD:280377
l3mbtl3NP_001232893.1 MBT 206..302 CDD:214723 46/97 (47%)
MBT 313..409 CDD:214723 47/99 (47%)
MBT 421..513 CDD:214723 41/92 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87248666
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130415
Panther 1 1.100 O PTHR12247
Phylome 1 0.910 0.771 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5341
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.