DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_005158395.1 Gene:phc1 ZFINID:ZDB-GENE-081022-39 Length:901 Species:Danio rerio

Alignment Length:809 Identity:155/810 (19%)
Similarity:257/810 (32%) Gaps:288/810 (36%)


  Fly     3 PLSMASAEAKQLQRNISLSMSPANGGV-----ISPSTANCNGVASAS---GGNPNPNSLLTL--- 56
            |.:.||......|..::||.:.|.|.:     |.|:|:..:...|.|   |||......:.|   
Zfish    91 PNNSASQPTSSAQCTVNLSTTSAGGTMTNPRPIGPATSAASTALSQSVLLGGNSGGQGQMYLRVN 155

  Fly    57 ----APRKEELRFLPLAPMGGNKTCNI-TISNVQPMK------SKLKSVNIVPNSIKSAG----- 105
                ||...:|.|:|    ||..|..: |::..||.:      .:.:.....|.|..|..     
Zfish   156 RSLRAPLTPQLIFMP----GGTATATVATVAQTQPQQQPQQQPQQQQQQEATPTSSSSQSDNDQV 216

  Fly   106 -----------AGATVGSADA---------PLFQLVPSP-------------------------- 124
                       ..|||.:..|         ||.|...:|                          
Zfish   217 QNLAMRCVSTPRAATVKTEFADRKETTGTFPLNQQTQTPQQFGQSTQQVQPQTQPLANAKLQSFS 281

  Fly   125 --SNPSQPLVAILAPNRKTTL-LGGGASNGQP-----------VVIRSGTPLHK----------- 164
              :|||.|.:.:...|:.... ...|||:..|           .::.|.:.||:           
Zfish   282 NTANPSVPALNVKPTNQSAVAPQQAGASSNPPSSSPTPSLPLSQLLLSQSGLHQTRGVPGSTATV 346

  Fly   165 NSLTVETSNKP-----------------------IQP----GGSAAAAAVGGGTGGAPL---TLV 199
            ..:.|.|||.|                       :||    |.:.:...:..|||..|:   |..
Zfish   347 THILVPTSNVPTSTQGYPLGTVATKSNMTAQTLVVQPLQQTGANLSTEKLAHGTGHVPIQPKTAQ 411

  Fly   200 GKTV--------------VPPKIQAAT----PVQIPSTGPGAQVSLLANPLKPRAPLILSKVAVD 246
            |..|              .||....||    |..:|....||:.|.|.|.         ..:|:.
Zfish   412 GHRVPVQMSPRHPPPILPAPPNNGQATAGLHPPHVPVQLVGARQSTLGNS---------QALALA 467

  Fly   247 KLRLKFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTAM 311
            :.|...|| :....|:.:....:|..::|:.:.||......|                  .::|:
Zfish   468 QARTCCSQ-QDGTAAVGVNNPGNVVTMVTAMDTSGAGMCLKT------------------AQSAL 513

  Fly   312 PIATEVPTADNNKMSLIKSKPVAI-----------KAVPLPSQEAPIVPAVAPVVT--------- 356
            || :::.|  |....|.:..|.::           .::.:.|.:|.|.||:.|:..         
Zfish   514 PI-SQMQT--NQSAVLSQGNPASVTHSMDGQNNSGDSLFVQSAQAQIKPAIGPIKRKSESDLTHE 575

  Fly   357 --------SPEKVDVKP--TAKPSIKTAPK---PTPKPLEMSV-----NGPAKEKKAPAKEQKQK 403
                    ||...|..|  :..||:.|.|:   .:|..|.:|:     .|..:..:||..:    
Zfish   576 ISNEPISGSPSMQDSAPPLSPAPSLDTVPEIAFSSPPTLSLSLPLPLPRGAGQGDRAPVPQ---- 636

  Fly   404 TMDKPPVVKEIAQHTPCGPKELPKLKRSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPSAA 468
            .:.||.|:..:.:                .||....|.|       ..|....||:      |.|
Zfish   637 AVVKPQVLTHLIE----------------GFVIQEGAEP-------FPVTGPLKEL------SGA 672

  Fly   469 IETITIEDDDESEEEQQKPEIKKTPKQNQKPEKQ----EAPKKKQIPM------------PILPA 517
            :..|...:|..|::.:.:..:...|....:..|:    ...|:..:..            ...||
Zfish   673 VPPILHPEDIRSDKLKCEYCLNFAPASQFRRSKRFCTISCSKRYNVSFRNHLRASRGLEGAERPA 737

  Fly   518 GITISTTSTAKKKAVRKNSSVTTISSSS---------SDSSSYSDVEVVPTKKTEKELSMLPGIS 573
            |..:.....|:::|.|::||....:..:         |:||...|:.....::.|..||:.|..:
Zfish   738 GGPVVQDVIARRRAPRRSSSEIACAKITGRHLPVKCRSESSRSDDISSCEGEEEEDFLSLSPSST 802

  Fly   574 IIKAESLPLSREDFERSLRCDEQVPQTPP 602
            .    |.|       |...|..|:..|.|
Zfish   803 F----SCP-------RPTHCGPQLDDTAP 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
phc1XP_005158395.1 PHC2_SAM_assoc <763..832 CDD:293222 15/70 (21%)
SAM_Ph1,2,3 834..901 CDD:188976
SAM 835..901 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87334809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.