DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and phc2b

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_957496.3 Gene:phc2b ZFINID:ZDB-GENE-040426-1113 Length:890 Species:Danio rerio

Alignment Length:898 Identity:171/899 (19%)
Similarity:283/899 (31%) Gaps:306/899 (34%)


  Fly    13 QLQRNISLSMSPANGGVISPSTANCNGVASASGGNPNPNSLLTLAPRKEELRFLPLAPMGGNKTC 77
            |||...::..:....|   ..::|.||.:|...|:......||.:|...:|              
Zfish   148 QLQSLAAVQQASLAAG---RQSSNQNGTSSTQSGSSQTTINLTTSPAAAQL-------------- 195

  Fly    78 NITISNVQPMKSKLKSVNIVPNSIKSA------GAGATVGSADAPLF------------------ 118
               ||..|       |||..|:.|...      .:.:|:.::.|.::                  
Zfish   196 ---ISRAQ-------SVNSAPSGISQQAVLLGNASSSTLTASQAQMYLRAQMAQQSNLVHVARSL 250

  Fly   119 -QLVPSPSNPSQPLVAILAPNRKTTLLGGGASNGQPVVIRSGTPLHKNSLTVETSNKPIQ--PGG 180
             :.||..|.      .||||....|.|...          :.|..:..|.:.:..|..::  .|.
Zfish   251 GRAVPLSSQ------LILAPTATVTALQSD----------TNTTNNTQSASAQVQNLALRNHQGV 299

  Fly   181 SAAAAAVGGGTGGAPLTLVGKTVVPPKIQAATPVQIPSTGPGAQVSLLANPLKPRAPLILSKVAV 245
            |:...|.|       |..:.....|..||....::.||...||.                     
Zfish   300 SSTPQATG-------LQALSLKQTPVSIQPTPLIKTPSQSTGAG--------------------- 336

  Fly   246 DKLRLKFSQVKSNPNALVLGKANHVKKLLTSPNPSGEDKTRSTQKNNKQNTSASQLKPVVAPKTA 310
                      |:|.||   ..::.|||       :.|.:|.....|..:|.|:|.  |::||   
Zfish   337 ----------KNNLNA---ASSDGVKK-------AEEGQTEMKAVNMSRNVSSSH--PLIAP--- 376

  Fly   311 MPIATEVPTADNNKMSLIKSKPVAIKAVPLPSQEAPIVPAVAPVVTSPEKVDVKPTAKPSIKTAP 375
                   ..|.....:|||.:|          |:..|.|...|...|..::....:.:|..:||.
Zfish   377 -------AYAQIQPQALIKQQP----------QQFVIQPQATPTSRSQPQLLQTASIQPHQQTAS 424

  Fly   376 KPTPKPLEMS-VNG-------PAKEKKAPAKEQKQKTMDKPPV---VKEIAQHTPCGPKELPKLK 429
            ...|...:.| |.|       ||...:..|:.| |.|:....|   ......|....|.:|..:.
Zfish   425 LGIPSSAQTSTVTGIIPVLPKPALHNQGSAQTQ-QATIFHSTVSHHAHTALAHAKAQPVQLTAIN 488

  Fly   430 RSKSFVSNHPASPVANNERRHSVAIMAKEVDVIEQPSAAIETITIEDDDESEEEQQKPEIKKTPK 494
            .......|. ||.:|.:::....:::.:|:    .|...|...|.....:..|:.:...:..|.:
Zfish   489 LQIQPAQNQ-ASRLAQDDKEKPTSLVLREI----CPPVQIHPSTTTQGTDPPEQSKADTVNATSQ 548

  Fly   495 QNQKPEKQEAPKKKQIPMPILPAGITISTTSTAKKKAVRKNSSVTTISSSSSDSSSYSDVEVVPT 559
            .....|....|...|     |.:.:|.:.:|.....||..|   ||.:..:....:.    |.|.
Zfish   549 TQGSVETAREPTGAQ-----LTSSMTSAVSSEPPPAAVMGN---TTQNGENKPPQAI----VKPH 601

  Fly   560 KKTEKELSMLPGISIIK-AESLPLSREDFERSLRCDEQVPQTPPKSSSSSSSGSHASEMSPPPKL 623
            ..|.    ::.|..|.: ||..|:.|                ||.::.|             ||.
Zfish   602 VLTH----VIEGFVIQEGAEPFPVER----------------PPVAAES-------------PKK 633

  Fly   624 ADPKPSSPPAKNAKKANDHDANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFELNEF 688
            .|.:..|.|.|.|       ::.|.|:..:|.:::           |||...::..|.:.:|.  
Zfish   634 PDTQLPSDPEKTA-------SSNSLSATNSDTEEA-----------GQQDTRVEEETEKPKLT-- 678

  Fly   689 NFLQINERCQPRQGPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAADFL-----APHFC 748
                                                     |:.|.:    .||.     :..||
Zfish   679 -----------------------------------------CELCGW----VDFAHKFKRSKRFC 698

  Fly   749 SVGCVRRSQKRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQ-EQLQQRQK 812
            |:.|.:|             ..:|.|              ||...::|.::.|..| .|.::|:.
Zfish   699 SMVCAKR-------------YSVSCT--------------KRVGLFRPDRTKSTNQINQWRRRRS 736

  Fly   813 DKPR----KPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDP 861
            ..||    |..|.|...:|:|:.:::|:....:....|| |.:|....||..|
Zfish   737 HSPRGREAKKQRLSVSQQSQGESISSPLQSQPSQGESSP-CSDISSYEEATSP 788

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 11/41 (27%)
MBT 929..1028 CDD:214723
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
phc2bNP_957496.3 TFIIA 389..>554 CDD:281188 33/181 (18%)
PHC2_SAM_assoc 708..820 CDD:293222 24/97 (25%)
SAM_Ph1,2,3 822..889 CDD:188976
SAM 823..890 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.