DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)mbt and Scml2

DIOPT Version :9

Sequence 1:NP_733209.1 Gene:l(3)mbt / 43288 FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_038956122.1 Gene:Scml2 / 367793 RGDID:1564289 Length:1063 Species:Rattus norvegicus


Alignment Length:212 Identity:78/212 - (36%)
Similarity:106/212 - (50%) Gaps:6/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLS 883
            |.|.:|||..| .|:||...|........|.|:|||||||.||.|....||.|::.:.|.||:|.
  Rat    46 FDWDKYLKETG-SVSAPSEYFRQAKTPPTNEFQIGMKLEARDPRNIDSVCVASVIGITGARLRLR 109

  Fly   884 FDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALFG 946
            .||..:..|||...||.||.|.|.|::...:||.|..|.....||..:|::  ||.:.||...| 
  Rat   110 LDGGDNKNDFWRLVDSSDIQPVGTCEQEGDLLQPPLGYRMNASSWPMFLLRVLTGSELAPAVFF- 173

  Fly   947 HLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPY 1011
              ..:.....:|.|.|||.:||.|..:...||.||:..:..:::.:.||||...:|.|....|..
  Rat   174 --KKEPPRPPQNNFIVGMKIEAIDRKNPFMICPATIGAVSGDQVHITFDGWSGAFDYWCSYDSRD 236

  Fly  1012 IHPCGWHEGRQQLIVPP 1028
            |.|.||......::.||
  Rat   237 IFPVGWCRLTGDILQPP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 41/95 (43%)
MBT 929..1028 CDD:214723 29/100 (29%)
MBT 1038..1130 CDD:214723
SAM_PNT 1279..1366 CDD:280377
Scml2XP_038956122.1 MBT 49..144 CDD:214723 41/95 (43%)
MBT 162..253 CDD:214723 28/93 (30%)
rplD 676..>765 CDD:184900
SLED 806..915 CDD:403384
SAM_Scm 991..1061 CDD:188977
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343708
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.