DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Scml2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_008756631.1 Gene:Scml2 RGDID:1564289 Length:1009 Species:Rattus norvegicus

Alignment Length:474 Identity:123/475 (26%)
Similarity:178/475 (37%) Gaps:121/475 (25%)


  Fly   819 FRWSEYLKSKGKDVAAPIHLFLNPFPISPNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLS 883
            |.|.:|||..| .|:||...|........|.|:|||||||.||.|....||.|::.:.|.||:|.
  Rat    20 FDWDKYLKETG-SVSAPSEYFRQAKTPPTNEFQIGMKLEARDPRNIDSVCVASVIGITGARLRLR 83

  Fly   884 FDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALFG 946
            .||..:..|||...||.||.|.|.|::...:||.|..|.....||..:|::  ||.:.||...| 
  Rat    84 LDGGDNKNDFWRLVDSSDIQPVGTCEQEGDLLQPPLGYRMNASSWPMFLLRVLTGSELAPAVFF- 147

  Fly   947 HLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPY 1011
              ..:.....:|.|.|||.:||.|..:...||.||:..:..:::.:.||||...:|.|....|..
  Rat   148 --KKEPPRPPQNNFIVGMKIEAIDRKNPFMICPATIGAVSGDQVHITFDGWSGAFDYWCSYDSRD 210

  Fly  1012 IHPCGWHEGRQQLIVPPDYQKSAFIWDDYISEVGGMAASKELFTPRQPMEYQERMKLEVVDQRNP 1076
            |.|.||......::.||...:.                       |:|              |..
  Rat   211 IFPVGWCRLTGDILQPPGKIRE-----------------------RRP--------------RGR 238

  Fly  1077 CLIRP----ATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYLQPK 1137
            .:.||    .|.:..|....:.......:.:...|||:          :.|..:.:..||:.:||
  Rat   239 GMTRPGKFGTTSLENKVPGPEAAEKTMSSVFTDTLEDE----------DRTLKDFQAAPGWKKPK 293

  Fly  1138 SVMPCDVEGCRGFGNAKRFNLNVHALRECCP-----YAPEN--------WRQWRSKTVKPPRV-- 1187
            .         |||...        .:.|..|     .||..        .:.|..:| :|.||  
  Rat   294 G---------RGFIKP--------GIDEARPGKHDQGAPAGKKSKGRGFTKTWEGET-RPGRVVQ 340

  Fly  1188 ----------------------AP-ENIRRG------WAKKTKR-ACSEAKQAIKEDSQQEIVYP 1222
                                  || |..|||      |:.:.:. |..:|..|.|:...:.|..|
  Rat   341 VVPVEKKPKGKRVTTATDDEAAAPAEKKRRGKTVTTPWSDQPRLFADQQAAPAEKKRKGKTITTP 405

  Fly  1223 KVAEVVQ-AKRKTSPCEEK 1240
            ...:... |.:.|:|.|:|
  Rat   406 WTGQPRHFADQGTAPAEKK 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 41/96 (43%)
MBT 929..1028 CDD:214723 30/101 (30%)
MBT 1038..1130 CDD:214723 11/96 (11%)
SAM_PNT 1279..1366 CDD:280377
Scml2XP_008756631.1 MBT 23..118 CDD:214723 41/96 (43%)
MBT 136..227 CDD:214723 29/94 (31%)
Treacle 243..679 CDD:281536 41/211 (19%)
DUF3588 752..861 CDD:288954
SAM_Scm 937..1007 CDD:188977
SAM 939..1007 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87426388
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.