DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Scmh1

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:XP_008762249.1 Gene:Scmh1 RGDID:1305788 Length:718 Species:Rattus norvegicus

Alignment Length:717 Identity:166/718 (23%)
Similarity:248/718 (35%) Gaps:222/718 (31%)


  Fly   795 KP---HKSLSAIQEQLQQRQKDKPRKP--------FRWSEYLKSKGKDVAAPIHLFLNPFPISPN 848
            ||   |.|.||.|.|          :|        |.|.:||| :...|.||:|.|...:....|
  Rat    57 KPKYGHLSESASQYQ----------EPVDILELGHFTWDKYLK-ETSSVPAPVHCFKQSYTPPSN 110

  Fly   849 CFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETAR 913
            .|:|.|||||.||.|.:..|:.::|.:.|.||:|..||..:..|||...||.:|.|.|.|::...
  Rat   111 EFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSSEIQPIGNCEKNGG 175

  Fly   914 VLQAPKDYNSERFSWSRYLVKT--GGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGK 976
            :||.|..:.....||..:|:||  |.:.||..:|   :.:......|.|.:||.|||.|..:...
  Rat   176 MLQPPLGFRLNASSWPMFLLKTLNGAEMAPIKIF---HKEPPSPSHNFFKMGMKLEAVDRKNPHF 237

  Fly   977 ICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW--------HEGRQQLIVP------ 1027
            ||.||:.::....:.|.||||...:|.|....|..|.|.||        .....::::|      
  Rat   238 ICPATIGEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPSPS 302

  Fly  1028 -------PDYQKSAFIWDDYISEVGGMAASKELFTPR--------------QPMEYQERMKLEVV 1071
                   |....:..:.:....:.|.....|...||:              :|:::.::...:..
  Rat   303 SDVSTEKPSINSTKTVLEPQPGQRGRKPGKKRGRTPKILIPHPTSTPSKSAEPLKFPKKRGPKPG 367

  Fly  1072 DQRNP--CLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATSHELETPPGYL 1134
            .:|.|  .|..|.|..|                    .....||...:....||     .|...:
  Rat   368 SKRRPRTLLSPPPTSPT--------------------TSTPEPDTSTVPQDAAT-----IPSSAM 407

  Fly  1135 QPKSVMPC---DVEGCRG--------------FGNAKRFNLNVHALREC--CPYAPENWRQWRSK 1180
            |..:|  |   :..|..|              ||.|:...:...|::.|  |.|        ..|
  Rat   408 QAPTV--CIYLNKSGSTGPHLDKKKIQQLPDHFGPARASVVLQQAVQACIDCAY--------HQK 462

  Fly  1181 TVKPPRVAPENIRRGWAKKTKRACSEAKQAIKEDSQQEIVYPKVAEVVQAKR------------- 1232
            ||.      ..:::|..       .|...|:.:..|..:..|.|..:....|             
  Rat   463 TVF------SFLKQGHG-------GEVISAVFDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDN 514

  Fly  1233 --KTSPCEEKVVKKQKQMQKEEDAEQVPDE---------RSLA----IARSFVKDYGPQFL---- 1278
              ...|..:..|..............:|.|         |||.    :..|.:|   |..|    
  Rat   515 LFGNQPFTQTHVSLTATEYSHGHDRYLPGETFVLGNSLTRSLETHSDLMDSALK---PANLVSTS 576

  Fly  1279 -----PNYR------------------------------------LWQLNSA-------FKLDDV 1295
                 |.||                                    .|:||.:       ...|..
  Rat   577 QTLRTPGYRPLLPSCGLPLSTVSAVRRLCSRGVLKGTRERRDVESFWKLNHSPGSDRHLESRDPP 641

  Fly  1296 R---TNPLHWTSWDVCEYIERA---LDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAV 1354
            |   .:|..||..||.:::..|   |.|.  |.:..:.:|||:|||:|....:..|:.||:|||:
  Rat   642 RLSGRDPSSWTVEDVMQFVREADPQLGSH--ADLFRKHEIDGKALLLLRSDMMMKYMGLKLGPAL 704

  Fly  1355 KL 1356
            ||
  Rat   705 KL 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 38/96 (40%)
MBT 929..1028 CDD:214723 32/122 (26%)
MBT 1038..1130 CDD:214723 15/108 (14%)
SAM_PNT 1279..1366 CDD:280377 32/128 (25%)
Scmh1XP_008762249.1 MBT 85..180 CDD:214723 38/96 (40%)
MBT 191..289 CDD:214723 31/101 (31%)
DUF3588 411..519 CDD:288954 21/131 (16%)
SAM_Scm 645..715 CDD:188977 24/65 (37%)
SAM 648..715 CDD:197735 24/62 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86875352
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.