DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Sfmbt2

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001185737.1 Gene:Sfmbt2 MGIID:2447794 Length:975 Species:Mus musculus

Alignment Length:1010 Identity:197/1011 (19%)
Similarity:309/1011 (31%) Gaps:430/1011 (43%)


  Fly   758 KRRLPQSTQKESKISRTQLEQTAGTAPDLPQKRQTNYKPHKSLSAIQEQLQQRQKDKPRKPFRWS 822
            :|.||.|.::.|..|   ||:..|:|    ....|.|.        :|.....:.|     |.|.
Mouse     2 ERYLPVSKKRNSSSS---LEKITGSA----NGNGTLYS--------EEDTNLEEND-----FSWG 46

  Fly   823 EYLKSKGKDVAAPIHLFLNPFPIS-PNCFEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDG 886
            :||:..|.. |.| |:......|| .:.|:.|||||..:..|...:.|.:|:...|..|.|.:.|
Mouse    47 DYLEETGTR-AVP-HVSFRHVEISIRSNFQPGMKLEVANKNNPDTYWVATIITTCGQLLLLRYCG 109

  Fly   887 YSS--MYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVK--TGGKAAPRALF-G 946
            |..  ..|||.:....|:.|.|||.:..:||:.|.....:...|:.:|::  ||.:.||..|. |
Mouse   110 YGEDRRADFWCDVIIADLHPVGWCTQNNKVLRPPDAIKDKYSDWTDFLIRELTGSRTAPANLLEG 174

  Fly   947 HLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWD--DCYDLWVHITS 1009
            .|..:..:|:   ..|...:|.:|..:..:..:.:||:.:..|:|:.:.|.:  :.||.|:....
Mouse   175 PLRGKGPIDL---ITVDSLIELQDSQNPFQYWIVSVTENVGGRLRLRYVGLEHTESYDRWLFYLD 236

  Fly  1010 PYIHPCGWHEGRQQLIVPPD---YQKSAFIWDDYISEVGGMAASKEL---------------FT- 1055
            ..:.|.||.:..:..:.||.   |.|..|.|...:.:...:||...|               || 
Mouse   237 YRLRPIGWCQENKYRMDPPSELYYLKLPFEWKCALEKALVLAAESPLPMEVFKDHADLQSHFFTV 301

  Fly  1056 ----------------------------------------------------------------- 1055
                                                                             
Mouse   302 GMRLETLHISDPFHIYPASVTKVFNSKFFQVAIDDLRPEADKPTMLCHADSLGILPVQWCLKNGV 366

  Fly  1056 --------------------PRQPME-------------YQERMKLEVVDQRNPCLIRPATVVTR 1087
                                .||..|             :.:.||||.|:..||..:..||||:.
Mouse   367 NLAPPKGYSGQDFNWVDYHKQRQAEEAPHFCFKNAFSRGFSKNMKLEAVNPVNPGEVCVATVVSV 431

  Fly  1088 KGYRVQLHLDCWPTEYYFWLED-DSPDLHPIGWCEATSHELETP-----------------PGYL 1134
            ||..:.|||:...|.....:.| ||.|:.|:|||||.|:.|.||                 ...|
Mouse   432 KGRLLWLHLEGLETPMPDIIVDMDSMDIFPVGWCEANSYPLTTPYKASSKSKRKTVHFKMEKQLL 496

  Fly  1135 QPKSV---------MPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWR--------------- 1175
            .|..:         :|..::...|..|||          .|||....|.|               
Mouse   497 SPVPIEKIPHELCLLPPQMDSPVGAINAK----------YCCPQLFVNHRCFSGPFLNKGRISEL 551

  Fly  1176 ----------------------------------------QWRSK---------------TVKPP 1185
                                                    :|.|:               .||..
Mouse   552 PQSVGPGMCVLVLKEILTLITNAAYKPGRVLRELQLVEDPEWNSQEEILKAKYGGKTYRAVVKIV 616

  Fly  1186 RVA------------------------------PEN----IRRGWAKKTKRACSEAKQAIKEDS- 1215
            |.|                              |||    .:..:.|:.|.:.......:|:|| 
Mouse   617 RTADQVMNFCRQVCAKLECCPNLLSPVLISETCPENCSVHTKTRYNKREKGSSLSPASELKDDSA 681

  Fly  1216 -----------QQEIVYPKVAEVVQAKRKTSPCE--EKVVKKQKQ-----MQKE----------- 1251
                       .|...|.|...|:|:..:.|..|  .|..:::|:     :||.           
Mouse   682 SHATKLQKAKIPQTYYYGKRRRVIQSSLRVSNIETPPKSTRRRKRRKSVYVQKRRKSAIVVPAGV 746

  Fly  1252 ---------ED---------------------AEQVPDERSLAIARSFVKD-------------- 1272
                     ||                     .|.:|:....||..|..|.              
Mouse   747 PAGVPAGVPEDIPAGIPEGIPASIPESIPEGIPESLPESLPEAIPESIPKGSAQKTEQEKRETLD 811

  Fly  1273 --------YGPQFL--------------------------------------------------- 1278
                    :||.:.                                                   
Mouse   812 TARKKTGYHGPAYQTDTSAAQVPFARPRRAVTLRRNSEALKRPPVERARRVRTVPTTASSNNRVK 876

  Fly  1279 -PNYRLWQLNSAFKLDD----VRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLG 1338
             |..|:.:...:.:.|:    :.:|||.|:..||..:| :..|...:|::..||||||:|||:|.
Mouse   877 GPLVRIVKPEDSSQSDEEKLILESNPLEWSVTDVVRFI-KLTDCAPLARIFQEQDIDGQALLLLT 940

  Fly  1339 RKELDTYLKLKVGPAVKLYSLILNLRIAVVCKFDS 1373
            ...:...::||:|||:||...|..:::|...::.|
Mouse   941 LPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAS 975

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 32/99 (32%)
MBT 929..1028 CDD:214723 24/104 (23%)
MBT 1038..1130 CDD:214723 38/207 (18%)
SAM_PNT 1279..1366 CDD:280377 30/91 (33%)
Sfmbt2NP_001185737.1 MBT 47..143 CDD:214723 32/98 (33%)
MBT 155..255 CDD:214723 24/103 (23%)
MBT 275..371 CDD:214723 5/96 (5%)
MBT 383..475 CDD:214723 33/92 (36%)
DUF3588 528..643 CDD:288954 10/115 (9%)
TonB_N 743..>808 CDD:292650 8/65 (12%)
SAM_Scm-like-4MBT1,2 893..975 CDD:188980 28/83 (34%)
SAM 902..966 CDD:197735 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86667828
eggNOG 1 0.900 E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.