DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(3)mbt and Sfmbt

Sequence 1:NP_733209.1 Gene:l(3)mbt FlyBaseID:FBgn0002441 Length:1477 Species:Drosophila melanogaster
Sequence 2:NP_001137821.1 Gene:Sfmbt FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster

Alignment Length:1221 Identity:249/1222 (20%)
Similarity:409/1222 (33%) Gaps:442/1222 (36%)


  Fly   468 AIETITIED-----------DDESEEEQQKPEI-------------------------KKTPKQN 496
            |:|.:..:|           ||...|.:.|.||                         .|...|:
  Fly   130 AMEAVVDDDDQVYGQRDNNFDDNGSELEPKQEIINIDDFVMMNEDNNSYDGTDFMTSSDKDISQS 194

  Fly   497 ------QKPEKQEAPKKKQ---IPMP------------ILPA----------GITISTTSTAKKK 530
                  |.|.....|..:.   :|:|            ::||          .|.:||.:|:.|:
  Fly   195 SSSCMAQMPGSLGVPGVEHDLLVPLPDGLLHHKLLGTTLVPAMGTLNGNAFGNIMVSTENTSSKQ 259

  Fly   531 AVR-------KNSSVTTISSSSSDSSSYSDVEVVPTKKTEK-ELSMLPGISI---------IKAE 578
            ..|       .||:.||.:.|:|.||:...     .:||.| |....||:.:         |...
  Fly   260 MQRTYSTAKGANSTATTATCSASTSSALRS-----QRKTRKIEPVNRPGLVLKTPIAYRGNIDPS 319

  Fly   579 SLPLSREDFERSLRCDE-QVPQT-PPKS----SSSSSSGSHASEMSPPPKLADPKPSSPPAKNAK 637
            .:|:.::......||.. .|..| ..||    |.:.:.|...|.:.......|...:|.|     
  Fly   320 VIPIQKDGMAVCKRCGAIGVKHTFYTKSRRFCSMACARGELYSLVLNTKMEGDQATTSSP----- 379

  Fly   638 KANDHDANPSPSSKTNDFKKSMMQNLNMLKWRGQQPANLQNSTVRFEL-NEFNFLQINERCQPRQ 701
                   :|...|::.|......|:.:.:: .....|:::|:..||.: ::....|:|...:|..
  Fly   380 -------DPGAGSESADLPGDQQQSQSDIE-LDLHAAHIKNANYRFRITDQSKITQLNSFGEPMS 436

  Fly   702 --GPAAYFERPLYDRPGRRPSACVHPLLYLCQRCNFHGPAAD--FLAPHFCSVGCVRRSQKRRLP 762
              |.||                           .|....|||  ..|.:..:||      ....|
  Fly   437 MGGDAA---------------------------ANNVQMAADETIAALNGGAVG------DATAP 468

  Fly   763 QSTQKESKISRTQLEQTAGTAP-------------DLPQKRQTNYKP------HKSLSAIQEQLQ 808
            .||::.:....:.|  :|...|             ||||..:....|      .|.:|     ::
  Fly   469 GSTEEGASTPNSYL--SAAPTPKALRLFKDIYPQDDLPQIPKYERLPVPCPQMEKIIS-----IR 526

  Fly   809 QRQKDKPRKPFRWSEYLKSKGKDVAAPIHLFLNPFPISPNC-----FEIGMK----------LEA 858
            :|..| |...:.|...| ||....|||:    ..||.:|.|     ..:|||          :|.
  Fly   527 RRMYD-PTHSYDWLPRL-SKENFNAAPV----TCFPHAPGCEVWDNLGVGMKVEVENTDCDSIEV 585

  Fly   859 IDP-ENCSLFCVCSIVEVRGYRLKLSFDGY-SSMYDFWVNADSQDIFPPGWCDETARVLQAPKDY 921
            |.| :..:.|.|.:|:|::||:..:|::|: :..:|||||..:.::...|||....:.|..|:..
  Fly   586 IQPGQTPTSFWVATILEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTI 650

  Fly   922 NSERFSWSRYLV--KTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTD 984
            ..:...|..:||  .:|.:..|...:..:|...|    :.|.:|::||..|.:...::.:||||.
  Fly   651 EHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQ----SRFRLGLNLECVDKDRISQVRLATVTK 711

  Fly   985 ILDERIRVHFDGWDDCYDLWVHITSPYIHPCGW-----HE-------------GRQQLI------ 1025
            |:.:|:.:.:...||.:  |.|..||.|||.||     |.             ||:.:|      
  Fly   712 IVGKRLFLRYFDSDDGF--WCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDD 774

  Fly  1026 ----------------------------------------------------------------- 1025
                                                                             
  Fly   775 ATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPD 839

  Fly  1026 -----------------------------VPPD-YQKSAFIWDDYISEVGGMAASKELFTPRQPM 1060
                                         .||: |....|.|:.|:.:.|.:||.:.||....|.
  Fly   840 ASGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHRIIPD 904

  Fly  1061 E-YQERMKLEVVDQRNPCLIRPATVVTRKGYRVQLHLDCWPTEYYFWLEDDSPDLHPIGWCEATS 1124
            . ::..|.||..|..:|.|:..|||....|..:::|.|.|..||..||:.:|.|::|:|||...:
  Fly   905 HGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVN 969

  Fly  1125 HELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPENWRQWRSKTVKPPRVAP 1189
            |:||.||                                              |....:.|:.||
  Fly   970 HKLEGPP----------------------------------------------RVAHQQAPKPAP 988

  Fly  1190 E-NIRRGWAKKTKRACSEAK-------QAIKEDSQQEIVYPKVAEVVQAKRKTSPCEEKVVKKQK 1246
            : .|:|  .:|.|:..:..|       |::|..:......|.:.: :..|.:..|........:.
  Fly   989 KPKIQR--KRKPKKGAAGGKTPTDNNTQSVKSRTIALKTTPHLPK-LSIKLELKPEHHNAAFYEN 1050

  Fly  1247 QMQKEEDAEQVPD-------------ERSL-----------------------------AIARSF 1269
            ...:||..|:.||             |:|.                             .:.:|.
  Fly  1051 NQPEEEGDEEDPDADGDGDGSTSHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKST 1115

  Fly  1270 VKDYGP--------QFLPNYRLWQLNSAFKLDDVRTNPLH-------WTSWDVCEYIERALDSTD 1319
            .|...|        .::.|..........:|.|:.::..|       |..:||.::: |..|.|.
  Fly  1116 TKSPAPPTVGRKATSYIANSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFL-RVNDCTA 1179

  Fly  1320 IAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLRIAVVCK 1370
            .........|||:.||.|.:.::...|.:|||||:|:..||..|:    ||
  Fly  1180 HCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLK----CK 1226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(3)mbtNP_733209.1 MBT 822..918 CDD:214723 33/113 (29%)
MBT 929..1028 CDD:214723 33/219 (15%)
MBT 1038..1130 CDD:214723 33/93 (35%)
SAM_PNT 1279..1366 CDD:280377 26/94 (28%)
SfmbtNP_001137821.1 MBT 542..647 CDD:214723 33/110 (30%)
MBT 658..753 CDD:214723 29/101 (29%)
MBT 767..871 CDD:214723 2/104 (2%)
MBT 882..975 CDD:214723 33/93 (35%)
TonB_N <975..1040 CDD:292650 15/114 (13%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 23/71 (32%)
SAM 1160..1224 CDD:197735 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87331392
eggNOG 1 0.900 E1_KOG3766
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12247
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.